Entry |
|
Symbol |
CDC26, ANAPC12, APC12, C9orf17
|
Name |
(RefSeq) cell division cycle 26
|
KO |
K03359 | anaphase-promoting complex subunit 12 |
|
Organism |
|
Pathway |
hsa04914 | Progesterone-mediated oocyte maturation |
hsa05166 | Human T-cell leukemia virus 1 infection |
|
Network |
nt06160 Human T-cell leukemia virus 1 (HTLV-1) nt06230 Cell cycle (cancer) nt06512 Chromosome cohesion and segregation nt06515 Regulation of kinetochore-microtubule interactions |
Element |
N00221 | HTLV-1 Tax to spindle assembly checkpoint signaling |
N00493 | Spindle assembly checkpoint signaling |
N01486 | Cohesin dissociation in anaphase |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04120 Ubiquitin mediated proteolysis
246184 (CDC26)
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
246184 (CDC26)
04114 Oocyte meiosis
246184 (CDC26)
09150 Organismal Systems
09152 Endocrine system
04914 Progesterone-mediated oocyte maturation
246184 (CDC26)
09160 Human Diseases
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
246184 (CDC26)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04121 Ubiquitin system [BR:hsa04121]
246184 (CDC26)
03036 Chromosome and associated proteins [BR:hsa03036]
246184 (CDC26)
Ubiquitin system [BR:hsa04121]
Ubiquitin ligases (E3)
Multi subunit Ring-finger type E3
APC/C
Other subunits
246184 (CDC26)
Chromosome and associated proteins [BR:hsa03036]
Eukaryotic type
Sister chromatid separation proteins
APC/C complex
246184 (CDC26)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
Position |
9:complement(113266992..113275572)
|
AA seq |
85 aa
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQM
INDRIGYKPQPKPNNRSSQFGSLEF |
NT seq |
258 nt +upstreamnt +downstreamnt
atgctgagacggaaaccaacacgcctagagctaaagcttgatgacattgaagagtttgag
aacattcgaaaggacctggagacccgtaagaaacagaaggaagatgtggaagttgtagga
ggcagtgatggagaaggagccattgggcttagcagtgatcccaagagccgggaacaaatg
atcaatgatcggattggttataaaccccaacccaagcccaataatcgttcatctcaattt
ggaagtcttgaattttag |