KEGG   Homo sapiens (human): 54205
Entry
54205             CDS       T01001                                 
Symbol
CYCS, CYC, HCS, THC4
Name
(RefSeq) cytochrome c, somatic
  KO
K08738  cytochrome c
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05222  Small cell lung cancer
hsa05416  Viral myocarditis
hsa05417  Lipid and atherosclerosis
Network
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06231  Apoptosis (cancer)
nt06260  Colorectal cancer
nt06263  Hepatocellular carcinoma
nt06267  Small cell lung cancer
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
nt06466  Pathways of neurodegeneration
nt06524  Apoptosis
nt06528  Calcium signaling
  Element
N00098  Intrinsic apoptotic pathway
N00099  Mutation-inactivated BAX to apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00449  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
N00478  EBV BARF1 to intrinsic apoptotic pathway
N00745  IAV PB1-F2 to intrinsic apoptotic pathway
N00957  Mutation-caused abberant ATXN2/3 to mGluR5-Ca2+ -apoptotic pathway
N00967  VGCC-Ca2+ -apoptotic pathway
N00984  mGluR5-Ca2+ -apoptotic pathway
N00985  Mutation-caused aberrant Htt to mGluR5-Ca2+ -apoptotic pathway
N00987  Mutation-caused aberrant Htt to transport of calcium
N01000  mAChR-Ca2+ -apoptotic pathway
N01001  Mutation-caused aberrant Abeta to mAchR-Ca2+ -apoptotic pathway
N01002  Mutation-caused aberrant Abeta to mGluR5-Ca2+ -apoptotic pathway
N01003  Mutation-caused aberrant Abeta to transport of calcium
N01004  Mutation-caused aberrant Abeta to VGCC-Ca2+ -apoptotic pathway
N01005  Mutation-caused aberrant Abeta to crosstalk between extrinsic and intrinsic apoptotic pathways
N01006  Mutation-caused aberrant Abeta to VGCC-Ca2+ -apoptotic pathway
N01007  Mutation-caused aberrant PSEN to mGluR5-Ca2+ -apoptotic pathway
N01008  Mutation-caused aberrant PSEN1 to mGluR5-Ca2+ -apoptotic pathway
N01031  Mutation-caused aberrant SNCA to VGCC-Ca2+ -apoptotic pathway
N01047  Mutation-activated LRRK2 to intrinsic apoptotic pathway
N01048  Mutation-inactivated PINK1 to intrinsic apoptotic pathway
N01049  Mutation-inactivated PRKN to intrinsic apoptotic pathway
N01050  Mutation-inactivated PINK1 to intrinsic apoptotic pathway
N01135  Mutation-caused aberrant SOD1 to intrinsic apoptotic pathway
N01151  Mutation-inactivated SIGMAR1 to Ca2+ -apoptotic pathway
N01199  Scrapie conformation PrPSc to mGluR5-Ca2+ -apoptotic pathway
N01200  Scrapie conformation PrPSc to transport of calcium
Disease
H00978  Thrombocytopenia (THC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    54205 (CYCS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    54205 (CYCS)
   04215 Apoptosis - multiple species
    54205 (CYCS)
   04115 p53 signaling pathway
    54205 (CYCS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54205 (CYCS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    54205 (CYCS)
   05222 Small cell lung cancer
    54205 (CYCS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    54205 (CYCS)
   05161 Hepatitis B
    54205 (CYCS)
   05160 Hepatitis C
    54205 (CYCS)
   05164 Influenza A
    54205 (CYCS)
   05162 Measles
    54205 (CYCS)
   05168 Herpes simplex virus 1 infection
    54205 (CYCS)
   05163 Human cytomegalovirus infection
    54205 (CYCS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    54205 (CYCS)
   05169 Epstein-Barr virus infection
    54205 (CYCS)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    54205 (CYCS)
   05132 Salmonella infection
    54205 (CYCS)
   05131 Shigellosis
    54205 (CYCS)
   05134 Legionellosis
    54205 (CYCS)
   05152 Tuberculosis
    54205 (CYCS)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    54205 (CYCS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    54205 (CYCS)
   05012 Parkinson disease
    54205 (CYCS)
   05014 Amyotrophic lateral sclerosis
    54205 (CYCS)
   05016 Huntington disease
    54205 (CYCS)
   05017 Spinocerebellar ataxia
    54205 (CYCS)
   05020 Prion disease
    54205 (CYCS)
   05022 Pathways of neurodegeneration - multiple diseases
    54205 (CYCS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    54205 (CYCS)
   05416 Viral myocarditis
    54205 (CYCS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    54205 (CYCS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    54205 (CYCS)
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Other DBs
NCBI-GeneID: 54205
NCBI-ProteinID: NP_061820
OMIM: 123970
HGNC: 19986
Ensembl: ENSG00000172115
UniProt: P99999 G4XXL9
Structure
Position
7:complement(25118656..25125260)
AA seq 105 aa
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctctttgggcggaag
acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcatcatctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggcagacttaatagcttatctcaaa
aaagctactaatgagtaa

DBGET integrated database retrieval system