Entry |
|
Symbol |
Rhoa, Arha, Arha1, Arha2
|
Name |
(RefSeq) ras homolog family member A
|
KO |
K04513 | Ras homolog gene family, member A |
|
Organism |
mmu Mus musculus (house mouse)
|
Pathway |
mmu04072 | Phospholipase D signaling pathway |
mmu04270 | Vascular smooth muscle contraction |
mmu04621 | NOD-like receptor signaling pathway |
mmu04625 | C-type lectin receptor signaling pathway |
mmu04660 | T cell receptor signaling pathway |
mmu04670 | Leukocyte transendothelial migration |
mmu04810 | Regulation of actin cytoskeleton |
mmu04928 | Parathyroid hormone synthesis, secretion and action |
mmu05100 | Bacterial invasion of epithelial cells |
mmu05163 | Human cytomegalovirus infection |
mmu05418 | Fluid shear stress and atherosclerosis |
|
Brite |
KEGG Orthology (KO) [BR:mmu00001]
09130 Environmental Information Processing
09132 Signal transduction
04014 Ras signaling pathway
11848 (Rhoa)
04015 Rap1 signaling pathway
11848 (Rhoa)
04310 Wnt signaling pathway
11848 (Rhoa)
04350 TGF-beta signaling pathway
11848 (Rhoa)
04072 Phospholipase D signaling pathway
11848 (Rhoa)
04071 Sphingolipid signaling pathway
11848 (Rhoa)
04024 cAMP signaling pathway
11848 (Rhoa)
04022 cGMP-PKG signaling pathway
11848 (Rhoa)
04150 mTOR signaling pathway
11848 (Rhoa)
09140 Cellular Processes
09141 Transport and catabolism
04144 Endocytosis
11848 (Rhoa)
09144 Cellular community - eukaryotes
04510 Focal adhesion
11848 (Rhoa)
04520 Adherens junction
11848 (Rhoa)
04530 Tight junction
11848 (Rhoa)
09142 Cell motility
04810 Regulation of actin cytoskeleton
11848 (Rhoa)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
11848 (Rhoa)
04621 NOD-like receptor signaling pathway
11848 (Rhoa)
04625 C-type lectin receptor signaling pathway
11848 (Rhoa)
04660 T cell receptor signaling pathway
11848 (Rhoa)
04670 Leukocyte transendothelial migration
11848 (Rhoa)
04062 Chemokine signaling pathway
11848 (Rhoa)
09152 Endocrine system
04921 Oxytocin signaling pathway
11848 (Rhoa)
04928 Parathyroid hormone synthesis, secretion and action
11848 (Rhoa)
09153 Circulatory system
04270 Vascular smooth muscle contraction
11848 (Rhoa)
09154 Digestive system
04972 Pancreatic secretion
11848 (Rhoa)
09156 Nervous system
04722 Neurotrophin signaling pathway
11848 (Rhoa)
09158 Development and regeneration
04360 Axon guidance
11848 (Rhoa)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
11848 (Rhoa)
05206 MicroRNAs in cancer
11848 (Rhoa)
05205 Proteoglycans in cancer
11848 (Rhoa)
05203 Viral carcinogenesis
11848 (Rhoa)
09162 Cancer: specific types
05210 Colorectal cancer
11848 (Rhoa)
09172 Infectious disease: viral
05163 Human cytomegalovirus infection
11848 (Rhoa)
09171 Infectious disease: bacterial
05132 Salmonella infection
11848 (Rhoa)
05135 Yersinia infection
11848 (Rhoa)
05133 Pertussis
11848 (Rhoa)
05152 Tuberculosis
11848 (Rhoa)
05100 Bacterial invasion of epithelial cells
11848 (Rhoa)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
11848 (Rhoa)
05418 Fluid shear stress and atherosclerosis
11848 (Rhoa)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:mmu04131]
11848 (Rhoa)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:mmu04147]
11848 (Rhoa)
04031 GTP-binding proteins [BR:mmu04031]
11848 (Rhoa)
Membrane trafficking [BR:mmu04131]
Endocytosis
Lipid raft mediated endocytosis
RhoA-dependent endocytosis
11848 (Rhoa)
Exosome [BR:mmu04147]
Exosomal proteins
Exosomal proteins of haemopoietic cells (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
11848 (Rhoa)
Exosomal proteins of other body fluids (saliva and urine)
11848 (Rhoa)
Exosomal proteins of colorectal cancer cells
11848 (Rhoa)
Exosomal proteins of bladder cancer cells
11848 (Rhoa)
GTP-binding proteins [BR:mmu04031]
Small (monomeric) G-proteins
Rho Family
RhoA/B/C [OT]
11848 (Rhoa)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
Position |
9:108183359..108215142
|
AA seq |
193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLIL |
NT seq |
582 nt +upstreamnt +downstreamnt
atggctgccatcaggaagaaactggtgattgttggtgatggagcttgtggtaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtctatgtgcccacggtgtttgaa
aactatgtggcggatatcgaggtggatgggaagcaggtagagttggctttatgggacaca
gctggacaggaagattatgaccgcctgcggcctctctcttatccagacaccgatgttata
ttgatgtgtttttccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccagaagtcaagcatttctgtccaaatgtgcccatcatcctggttgggaacaagaaggac
cttcggaatgacgagcacacgagacgggagttggccaaaatgaagcaggagccggtaaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgagatggccacgagagctgctctgcaa
gctagacgtgggaagaaaaagtctgggtgcctcatcttgtga |