Entry |
|
Symbol |
Fcer1g, CD23, FcR-gamma, FcR[g], FcRgamma, Fce1g, FcepsilonRI, Ly-50
|
Name |
(RefSeq) Fc receptor, IgE, high affinity I, gamma polypeptide
|
KO |
K07983 | high affinity immunoglobulin epsilon receptor subunit gamma |
|
Organism |
mmu Mus musculus (house mouse)
|
Pathway |
mmu04072 | Phospholipase D signaling pathway |
mmu04625 | C-type lectin receptor signaling pathway |
mmu04650 | Natural killer cell mediated cytotoxicity |
mmu04664 | Fc epsilon RI signaling pathway |
|
Brite |
KEGG Orthology (KO) [BR:mmu00001]
09130 Environmental Information Processing
09132 Signal transduction
04072 Phospholipase D signaling pathway
14127 (Fcer1g)
04071 Sphingolipid signaling pathway
14127 (Fcer1g)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
14127 (Fcer1g)
04625 C-type lectin receptor signaling pathway
14127 (Fcer1g)
04650 Natural killer cell mediated cytotoxicity
14127 (Fcer1g)
04664 Fc epsilon RI signaling pathway
14127 (Fcer1g)
09160 Human Diseases
09171 Infectious disease: bacterial
05152 Tuberculosis
14127 (Fcer1g)
09163 Immune disease
05310 Asthma
14127 (Fcer1g)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:mmu04147]
14127 (Fcer1g)
Exosome [BR:mmu04147]
Exosomal proteins
Exosomal proteins of microglial cells
14127 (Fcer1g)
|
SSDB |
|
Motif |
|
Other DBs |
|
Position |
1:complement(171057141..171061918)
|
AA seq |
86 aa
MISAVILFLLLLVEQAAALGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREK
ADAVYTGLNTRSQETYETLKHEKPPQ |
NT seq |
261 nt +upstreamnt +downstreamnt
atgatctcagccgtgatcttgttcttgctccttttggtggaacaagcagccgccctggga
gagccgcagctctgctatatcctggatgctgtcctgtttttgtatggtattgtccttacc
ctactctactgtcgactcaagatccaggtccgaaaggcagctatagccagccgtgagaaa
gcagatgctgtctacacgggcctgaacacccggagccaggagacatatgagactctgaag
catgagaaaccaccccagtag |