GenomeNet

Database: Pfam
Entry: AF2331-like
LinkDB: AF2331-like
Original site: AF2331-like 
#=GF ID   AF2331-like
#=GF AC   PF14556.10
#=GF DE   AF2331-like protein
#=GF AU   Coggill P;0000-0001-5731-1588
#=GF SE   CATH:2fdoA00
#=GF GA   27.00 27.00;
#=GF TC   27.40 152.50;
#=GF NC   22.80 19.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   19768810
#=GF RT   The crystal structure of the AF2331 protein from Archaeoglobus
#=GF RT   fulgidus DSM 4304 forms an unusual interdigitated dimer with a
#=GF RT   new type of alpha + beta fold.
#=GF RA   Wang S, Kirillova O, Chruszcz M, Gront D, Zimmerman MD,
#=GF RA   Cymborowski MT, Shumilin IA, Skarina T, Gorodichtchenskaia E,
#=GF RA   Savchenko A, Edwards AM, Minor W;
#=GF RL   Protein Sci. 2009;18:2410-2419.
#=GF DR   INTERPRO; IPR028986;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   AF2331-like is a 11-kDa orphan protein of unknown function from
#=GF CC   Archaeoglobus fulgidus. The structure consists of an alpha +
#=GF CC   beta fold formed by an unusual homodimer, where the two core
#=GF CC   beta-sheets are interdigitated, containing strands alternating
#=GF CC   from both subunits. AF2331 contains multiple negatively charged
#=GF CC   surface clusters and is located on the same operon as the basic
#=GF CC   protein AF2330. It is suggested that AF2331 and AF2330 may form
#=GF CC   a charge-stabilized complex in vivo, though the role of the
#=GF CC   negatively charged surface clusters is not clear.
#=GF SQ   3
#=GS D2RIC1_ARCPA/1-90  AC D2RIC1.1
#=GS F2KSY2_ARCVS/1-93  AC F2KSY2.1
#=GS Y2331_ARCFU/1-90   AC O27953.1
D2RIC1_ARCPA/1-90             MPTYVFNENSFLDFIKKNV-EGKVAVVSSDVLDVDIEEMETH.LGVKKHFVVKFAISADVFKEVDLDKFDEILKYCVVFVESDEL.SEIGKKA
F2KSY2_ARCVS/1-93             MPTYVFDKEGFMKFLEKNLGEDTMVIVSSDVTDIDEASGNSYgLGKRDFYMVTIGVVADVFKEKDVDEFDEKPKYLVVFTSSDELtSEAIEKA
Y2331_ARCFU/1-90              MPAYVFSKESFLKFLEGHLEDDVVVVVSSDVTDFCKKLSESM.VGEKEYCFAEFAFPADIF-DADEDEIDEMMKYAIVFVEKEKL.SEAGRNA
#=GC seq_cons                 MPTYVFsKESFLKFLEKNLtEDsVVVVSSDVTDlDccpuESa.LGcK-aahVcFAlsADVFKEsDlDEFDEhhKYsVVFVESDEL.SEAG+KA
//
DBGET integrated database retrieval system