#=GF ID Acr30-35_AcrF1
#=GF AC PF20829.1
#=GF DE Anti-CRISPR protein Acr30-35/AcrF1
#=GF AU Bateman A;0000-0002-6982-4660
#=GF AU Lazaro Pinto Beatriz;0000-0001-6837-2941
#=GF SE ECOD:330.19.1
#=GF GA 30.50 30.50;
#=GF TC 192.00 191.90;
#=GF NC 30.40 23.20;
#=GF BM hmmbuild HMM.ann SEED.ann
#=GF SM hmmsearch --cpu 4 -E 1000 -Z 75585367 HMM pfamseq
#=GF TP Family
#=GF RC Paper describing PDB structure 5uz9
#=GF RN [1]
#=GF RM 28340349
#=GF RT Structure Reveals Mechanisms of Viral Suppressors that Intercept
#=GF RT a CRISPR RNA-Guided Surveillance Complex.
#=GF RA Chowdhury S, Carter J, Rollins MF, Golden SM, Jackson RN,
#=GF RA Hoffmann C, Nosaka L, Bondy-Denomy J, Maxwell KL, Davidson AR,
#=GF RA Fischer ER, Lander GC, Wiedenheft B;
#=GF RL Cell. 2017;169:47-57.
#=GF RC Paper describing PDB structure 5xlo
#=GF RN [2]
#=GF RM 28574055
#=GF RT Alternate binding modes of anti-CRISPR viral suppressors AcrF1/2
#=GF RT to Csy surveillance complex revealed by cryo-EM structures.
#=GF RA Peng R, Xu Y, Zhu T, Li N, Qi J, Chai Y, Wu M, Zhang X, Shi Y,
#=GF RA Wang P, Wang J, Gao N, Gao GF;
#=GF RL Cell Res. 2017;27:853-864.
#=GF RC Paper describing PDB structure 6anv
#=GF RN [3]
#=GF RM 28985564
#=GF RT Cryo-EM Structures Reveal Mechanism and Inhibition of DNA
#=GF RT Targeting by a CRISPR-Cas Surveillance Complex.
#=GF RA Guo TW, Bartesaghi A, Yang H, Falconieri V, Rao P, Merk A, Eng
#=GF RA ET, Raczkowski AM, Fox T, Earl LA, Patel DJ, Subramaniam S;
#=GF RL Cell. 2017;171:414-426.
#=GF DR SO; 0100021; polypeptide_conserved_region;
#=GF CC Pseudomonas phages have diverse anti-CRISPR (Acr) proteins that
#=GF CC subvert the immune systems in their hosts. These systems depend
#=GF CC on a CRISPR RNA (crRNA)-guided surveillance complex (Csy) for
#=GF CC the degradation of foreign DNA. This family represents AcrF1,
#=GF CC which inhibits DNA recognition of the Csy complex by interfering
#=GF CC with base pairing between the DNA target strand and crRNA
#=GF CC spacer. AcrF1 can use different mechanisms to block target DNA
#=GF CC recognition [1-3].
#=GF SQ 1
#=GS L7P7M1_9CAUD/1-78 AC L7P7M1.1
L7P7M1_9CAUD/1-78 MKFIKYLSTAHLNYMNIAVYENGSKIKARVENVVNGKSVGARDFDSTEQLESWFYGLPGSGLGRIENAMNEISRRENP
#=GC seq_cons MKFIKYLSTAHLNYMNIAVYENGSKIKARVENVVNGKSVGARDFDSTEQLESWFYGLPGSGLGRIENAMNEISRRENP
//