#=GF ID   Antig_Caf1
#=GF AC   PF09255.14
#=GF DE   Caf1 Capsule antigen
#=GF AU   Sammut SJ;0000-0003-4472-904X
#=GF SE   pdb_1p5v
#=GF GA   25.00 25.00;
#=GF TC   37.60 307.30;
#=GF NC   23.60 21.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch --cpu 4 -Z 75585367 -E 1000 HMM pfamseq
#=GF TP   Domain
#=GF WK   Caf1_capsule_antigen
#=GF CL   CL0204
#=GF RN   [1]
#=GF RM   12787500
#=GF RT   Structure and biogenesis of the capsular F1 antigen from
#=GF RT   Yersinia pestis: preserved folding energy drives fiber
#=GF RT   formation. 
#=GF RA   Zavialov AV, Berglund J, Pudney AF, Fooks LJ, Ibrahim TM,
#=GF RA   MacIntyre S, Knight SD; 
#=GF RL   Cell. 2003;113:587-596.
#=GF DR   INTERPRO; IPR015335;
#=GF DR   SCOP; 1p5v; fa;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   Members of this family are predominantly found in the F1 capsule
#=GF CC   antigen Caf1 synthesised by Yersinia bacteria. They adopt a
#=GF CC   structure consisting of a seven strands arranged in two
#=GF CC   beta-sheets, in a Greek-key topology, and mediate targeting of
#=GF CC   the bacterium to sites of infection [1].
#=GF SQ   1
#=GS CAF1_YERPE/35-170  AC P26948.1
CAF1_YERPE/35-170             VEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
#=GC seq_cons                 VEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
//