#=GF ID   Csa5_I-A
#=GF AC   PF21681.1
#=GF DE   Type-I-A Cascade subunit Csa5
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF AU   Lazaro Pinto Beatriz;0000-0001-6837-2941
#=GF SE   ECOD:EF19930
#=GF GA   30.30 30.30;
#=GF TC   31.50 187.70;
#=GF NC   27.30 30.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 --cpu 4 -E 1000 HMM pfamseq
#=GF TP   Family
#=GF RC   Paper describing PDB structure 3zc4
#=GF RN   [1]
#=GF RM   23846216
#=GF RT   Structure of the archaeal Cascade subunit Csa5: relating the
#=GF RT   small subunits of CRISPR effector complexes.
#=GF RA   Reeks J, Graham S, Anderson L, Liu H, White MF, Naismith JH;
#=GF RL   RNA Biol. 2013;10:762-769.
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This group of archaeal proteins includes CRISPR type I-A cluster
#=GF CC   1/Apern-associated protein Csa5-1 from Saccharolobus
#=GF CC   solfataricus (Csa5), the small subunit of the archaeal-specific
#=GF CC   Type-I-A Cascade complex for CRISPR-mediated antiviral immunity.
#=GF CC   This protein consists of two domains: an all alpha-helical
#=GF CC   arrangement and an insertion that shows a single helix and six
#=GF CC   beta-strands arranged as three anti-parallel two-stranded
#=GF CC   beta-sheets [1].
#=GF SQ   3
#=GS Q977B5_SULTO/5-159      AC Q977B5.1
#=GS CSA5A_SACS2/8-161       AC Q97YC8.1
#=GS A0A510E604_9CREN/5-156  AC A0A510E604.1
Q977B5_SULTO/5-159                 .ASEVGKNFRSLVKIFRFYVVLRRFGYIDPLIYSLDPKYIKDVITQALRDYTSYLASASKRTVALK-YKEEQIEDSIDCLVIAKKGDIPQTFKVAYPDVVHEIVDGSDKGMLCISPIVWSKNKKPYIVTPRR--VESFLDKVEKDVNYAKTLVSLAIGG.
CSA5A_SACS2/8-161                  .AETISKRFWTLIKMLRFYVVLRRFGYIDPLIYSIDPKQIKDVLSEALREFVSYTSSSSSRSIVIYDDPKNPVTAQAPCLVVAKRDEIPQNFPSIYRYTIYKIDKSSE---YCISPLVVN-DKYATLITPNESVIKEFFDKLDSNIQYARVLASLAVGG.
A0A510E604_9CREN/5-156             s-EVVGKEFRSLVKVFRFYIVLRRFNYIDPLIYALDTNCVRDVIAQALRDYTSYLSSATVKSVNLY-YKGQVKTYQIPCLVTAKSSEIPSTFLRAYPDIVHGVDKSDD---LCISPVTWTKHGNPVLVNPRK--VKDFLKNVEQDIGFARSLISIAVG-e
#=GC seq_cons                      .AEsVGKcFRSLVKlFRFYVVLRRFGYIDPLIYSLDPKpIKDVIoQALRDYTSYLSSASsRSVsLY.YKcpslTsQIPCLVlAK+uEIPQTFhsAYPDlVHcIDKSSD...LCISPlVWoKcKpPsLVTPR+..VK-FLDKVEpDIsYARoLlSLAVGG.
//