#=GF ID   DUF3195
#=GF AC   PF11424.12
#=GF DE   Protein of unknown function (DUF3195) N-terminal domain
#=GF AU   Pollington J;0000-0002-8158-8998
#=GF SE   pdb_1rki
#=GF GA   25.00 25.00;
#=GF TC   25.00 133.00;
#=GF NC   24.90 19.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Domain_of_unknown_function
#=GF RN   [1]
#=GF RM   16111437
#=GF RT   The genomics of disulfide bonding and protein stabilization in
#=GF RT   thermophiles. 
#=GF RA   Beeby M, O'Connor BD, Ryttersgaard C, Boutz DR, Perry LJ, Yeates
#=GF RA   TO; 
#=GF RL   PLoS Biol. 2005;3:e309.
#=GF DR   INTERPRO; IPR021540;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This archaeal family of proteins has no known function. This
#=GF CC   entry represents the N-terminal ferredoxin-like domain. 
#=GF SQ   2
#=GS Q8ZYK2_PYRAE/4-68  AC Q8ZYK2.1
#=GS G4RLL7_THETK/2-68  AC G4RLL7.1
Q8ZYK2_PYRAE/4-68             HIIIKTIPKKEEIISRDLCDCIYYY-DNSVICKPIGPSKVYVSTS-LENLEKCLQLHYFKKLVKNIE
G4RLL7_THETK/2-68             IALLTTLGGKERSVAQDLCDCLYGNGDTQVRCEPIYPGVLFVEFQRRETLELCLSMKYFRVLVRRIE
#=GC seq_cons                 hhllpTlstKEc.lupDLCDClYh..DspVhCcPIhPuhlaVphp.hEsLEhCLph+YF+hLV+pIE
//