#=GF ID   DUF3213
#=GF AC   PF11491.12
#=GF DE   Protein of unknown function (DUF3213)   
#=GF AU   Pollington J;0000-0002-8158-8998
#=GF SE   pdb_2f40
#=GF GA   27.00 27.00;
#=GF TC   47.70 98.30;
#=GF NC   25.60 20.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch --cpu 4 -E 1000 -Z 75585367 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF RN   [1]
#=GF RM   16927360
#=GF RT   Structure determination of a new protein from backbone-centered
#=GF RT   NMR data and NMR-assisted structure prediction. 
#=GF RA   Mayer KL, Qu Y, Bansal S, LeBlond PD, Jenney FE Jr, Brereton PS,
#=GF RA   Adams MW, Xu Y, Prestegard JH; 
#=GF RL   Proteins. 2006;65:480-489.
#=GF DR   INTERPRO; IPR021583;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   The backbone structure of this family of proteins has been
#=GF CC   determined however the function remains unknown. The protein has
#=GF CC   an alpha and beta structure with a ferredoxin-like fold [1].
#=GF SQ   4
#=GS F0LL32_THEBM/9-92   AC F0LL32.1
#=GS C6A2T9_THESM/5-88   AC C6A2T9.1
#=GS Q5JHH7_THEKO/15-98  AC Q5JHH7.1
#=GS Q8U0X6_PYRFU/3-84   AC Q8U0X6.1
F0LL32_THEBM/9-92              e-LKF-GRITPQEAMDLQYKLSVNPATYRVFINGYSKRGMIIFDEEKLPKEKLLEMLSELNPQIIEEKEISIEELVNSSMSWKNVM.
C6A2T9_THESM/5-88              .DFKF-DNITPEEARRMQYKLAINLAVYRVFLNGYSKSGYIIFDESKLSREEILQMLEEFKPEIIREKTLTPDELIIESLSWKNI-a
Q5JHH7_THEKO/15-98             .DLKF-GDINWEKATIKQYELEKDERVWRIFLNGYARNGFVIFDEELFPREELLKALEELKPEVVGEKTLTVQELIEESMSWNNVF.
Q8U0X6_PYRFU/3-84              .WIKFTTNLTPEEAKIVQYELSTRDEFYRVFINPYAKVAEVVIDDSKVNIEELKEKL---KGEVIEEKEITLQELIEGSLSWNNVL.
#=GC seq_cons                  ..lKF.ssITPEEAphhQYcLuhs.tsYRVFlNGYuKsGhlIFDEpKls+EELLchLpEhKPElIcEKplTlpELIppShSWpNVh.
//