GenomeNet

Database: Pfam
Entry: DUF4027
LinkDB: DUF4027
Original site: DUF4027 
#=GF ID   DUF4027
#=GF AC   PF13219.10
#=GF DE   Protein of unknown function (DUF4027)
#=GF AU   Aldam G;0000-0003-3039-8438
#=GF AU   Mistry J;0000-0003-2479-5322
#=GF SE   Pfam-B_2038 (release 24.0)
#=GF GA   25.00 25.00;
#=GF TC   98.70 98.50;
#=GF NC   23.20 19.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 --cpu 4 -E 1000 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR025104;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family of proteins is functionally uncharacterised. This
#=GF CC   family of proteins is found in bacteria. Proteins in this family
#=GF CC   are approximately 40 amino acids in length. There is a conserved
#=GF CC   CLGGF sequence motif.
#=GF SQ   1
#=GS A0A0F7RH77_BACAN/4-39  AC A0A0F7RH77.1
A0A0F7RH77_BACAN/4-39             MKALQDLSYSQGVGLICLGGFAASVTLAVVIKIIHQ
#=GC seq_cons                     MKALQDLSYSQGVGLICLGGFAASVTLAVVIKIIHQ
//
DBGET integrated database retrieval system