#=GF ID   DUF4969
#=GF AC   PF16339.9
#=GF DE   Domain of unknown function (DUF4969)
#=GF AU   Chang Y;0000-0002-2418-3433
#=GF SE   Jackhmmer BT_2807 (Q8A3Z7)
#=GF GA   31.40 31.40;
#=GF TC   31.70 117.80;
#=GF NC   30.60 28.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch --cpu 4 -E 1000 -Z 75585367 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR032512;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This small family consists of several uncharacterised proteins
#=GF CC   around 540 residues in length and is mainly found in various
#=GF CC   Bacteroides species. The function of this protein is unknown.
#=GF SQ   2
#=GS Q8A3Z7_BACTN/1-70  AC Q8A3Z7.1
#=GS Q8Y460_LISMO/1-79  AC Q8Y460.1
Q8A3Z7_BACTN/1-70             MYKRMIILTYALVFFSLFATACSD-NNNETYVEPILSQIEVS-----KLVTENNKTYVSVDGKP---FPFLGAQIRLDA
Q8Y460_LISMO/1-79             MKKRGLLLVSVLMLFIFLTVACGSSEDNEESGEISTKEIELTVDDPIIPTDENGEATIEGTVDPKSKLTIDGKAVKKDD
#=GC seq_cons                 MhKRhllLs.sLhhF.hhssACus.psNEp.sE..hppIElo.....h.ssENscshlpssscP...hsh.Gttl+hDs
//