#=GF ID   DUF6393
#=GF AC   PF19930.3
#=GF DE   Family of unknown function (DUF6393)
#=GF AU   Williams LS;0000-0001-5551-8526
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF AU   Fragoso S;0000-0001-7018-3891
#=GF SE   Manual
#=GF GA   26.90 26.90;
#=GF TC   26.90 181.00;
#=GF NC   26.50 20.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 --cpu 4 -Z 75585367 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF RN   [1]
#=GF RM   21609846
#=GF RT   Identification and characterization of the lysobactin
#=GF RT   biosynthetic gene cluster reveals mechanistic insights into an
#=GF RT   unusual termination module architecture.
#=GF RA   Hou J, Robbel L, Marahiel MA;
#=GF RL   Chem Biol. 2011;18:655-664.
#=GF DR   INTERPRO; IPR045656;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This entry represents a member of a biosynthetic gene cluster
#=GF CC   (BGC). This BGC (BGC0000385) is described by MIBiG as an example
#=GF CC   of the following biosynthetic class, NRP (non-ribosomal
#=GF CC   peptide), in  particular the lysobactin biosynthetic gene
#=GF CC   cluster from Lysobacter  sp. ATCC 53042 [1].
#=GF SQ   2
#=GS A0A3R8T0R9_9GAMM/56-151  AC A0A3R8T0R9.1
#=GS A0A1C7P3K5_9HYPH/2-97    AC A0A1C7P3K5.1
A0A3R8T0R9_9GAMM/56-151             LDEVVASGKPTGFDKIDVGDMLIARFPVGTRKEVVLRAFEGLRGVSIHDDTPGQLVVRYDRGRAMFDVDPRTIRATFSFDDNATLVSVRAVHMKNQ
A0A1C7P3K5_9HYPH/2-97               LEEVYASRKPVRFEQIDVDEIVLKHFPKGTGRTAVNEALKASVSSKITKNAADELVVRDDRGRAMLDPDARSIVITFRFDAAGTLTNVKAIYLKSQ
#=GC seq_cons                       L-EVhAStKPstF-pIDVs-hllt+FPhGTt+psV.cAhcu.huspIpcsssspLVVR.DRGRAMhDsDsRoIhhTFpFDssuTLssV+AlahKsQ
//