#=GF ID DYN1_lid
#=GF AC PF21499.1
#=GF DE DYN1, AAA+ ATPase lid domain
#=GF AU Bateman A;0000-0002-6982-4660
#=GF AU Chuguransky S;0000-0002-0520-0736
#=GF SE ECOD:EF15923
#=GF GA 27.00 27.00;
#=GF TC 37.30 267.00;
#=GF NC 22.30 20.50;
#=GF BM hmmbuild HMM.ann SEED.ann
#=GF SM hmmsearch -Z 75585367 --cpu 4 -E 1000 HMM pfamseq
#=GF TP Domain
#=GF CL CL0671
#=GF RC Paper describing PDB structure 3j67
#=GF RN [1]
#=GF RM 24727830
#=GF RT Structural mechanism of the dynein power stroke.
#=GF RA Lin J, Okada K, Raytchev M, Smith MC, Nicastro D;
#=GF RL Nat Cell Biol. 2014;16:479-485.
#=GF RC Paper describing PDB structure 3qmz
#=GF RN [2]
#=GF RM 21330489
#=GF RT Crystal structure of the dynein motor domain.
#=GF RA Carter AP, Cho C, Jin L, Vale RD;
#=GF RL Science. 2011;331:1159-1165.
#=GF RC Paper describing PDB structure 4ai6
#=GF RN [3]
#=GF RM 22426545
#=GF RT Insights into dynein motor domain function from a 3.3-A crystal
#=GF RT structure.
#=GF RA Schmidt H, Gleave ES, Carter AP;
#=GF RL Nat Struct Mol Biol. 2012;19:492-497.
#=GF RC Paper describing PDB structure 4w8f
#=GF RN [4]
#=GF RM 25417161
#=GF RT Allosteric communication in the dynein motor domain.
#=GF RA Bhabha G, Cheng HC, Zhang N, Moeller A, Liao M, Speir JA, Cheng
#=GF RA Y, Vale RD;
#=GF RL Cell. 2014;159:857-868.
#=GF RC Paper describing PDB structure 5vh9
#=GF RN [5]
#=GF RM 28886386
#=GF RT Lis1 Has Two Opposing Modes of Regulating Cytoplasmic Dynein.
#=GF RA DeSantis ME, Cianfrocco MA, Htet ZM, Tran PT, Reck-Peterson SL,
#=GF RA Leschziner AE;
#=GF RL Cell. 2017;170:1197-1208.
#=GF DR SO; 0000417; polypeptide_domain;
#=GF CC This entry includes dynein heavy chain (DYN1) from yeast, which
#=GF CC is a cytoplasmic dynein that acts as a motor for intracellular
#=GF CC retrograde motility of vesicles and organelles along
#=GF CC microtubules. This entry represents the AAA+ ATPase lid domain
#=GF CC [1-5].
#=GF SQ 2
#=GS J8PL59_SACAR/2227-2362 AC J8PL59.1
#=GS DYHC_YEAST/2223-2358 AC P36022.1
J8PL59_SACAR/2227-2362 FSKINCLLDKSYEALDSKLSMLGLEKVRSMISSAFDMTSLTNLFTKSDCLNHIMGIGSFNKIETAVQLITNLVLSYRQWLENTNDENLKNAIAQVVKRSLLYGLAGDTTDESQSTLIQVINTSFGYNSGELTDYSS
DYHC_YEAST/2223-2358 SSKIDHLLNKSYEALDNKLSMFELDKLKDLISDSFDMASLTNIFTCSNDLVHILGVRTFNKLETAVQLAVHLISSYRQWFQNLDDKSLKDVITLLIKRSLLYALAGDSTGESQRAFIQTINTYFGHDSQELSDYST
#=GC seq_cons .SKIspLLsKSYEALDsKLSMhtL-Kl+shISsuFDMsSLTNlFTpSssLsHIhGltoFNKlETAVQLhspLl.SYRQWhpNhsDcsLKssIs.llKRSLLYuLAGDoTsESQpshIQsINT.FGasStELoDYSo
//
