#=GF ID   EAD6
#=GF AC   PF19958.3
#=GF DE   Effector-associated domain 6
#=GF AU   Aravind L;0000-0003-0771-253X
#=GF AU   Iyer LM;0000-0002-4844-2022
#=GF SE   Aravind L
#=GF GA   27.00 27.00;
#=GF TC   27.20 165.50;
#=GF NC   22.20 20.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF CL   CL0041
#=GF RN   [1]
#=GF RM   32101166
#=GF RT   Highly regulated, diversifying NTP-dependent biological conflict
#=GF RT   systems with implications for the emergence of multicellularity.
#=GF RA   Kaur G, Burroughs AM, Iyer LM, Aravind L;
#=GF RL   Elife. 2020; [Epub ahead of print]
#=GF RN   [2]
#=GF RM   34061031
#=GF RT   Bacterial death and TRADD-N domains help define novel apoptosis
#=GF RT   and immunity mechanisms shared by prokaryotes and metazoans.
#=GF RA   Kaur G, Iyer LM, Burroughs AM, Aravind L;
#=GF RL   Elife. 2021; [Epub ahead of print]
#=GF DR   INTERPRO; IPR045433;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   Effector-associated domains (EADs) are predicted to function as
#=GF CC   adaptor domains mediating protein-protein interactions. The EADs
#=GF CC   show a characteristic architectural pattern. One copy is always
#=GF CC   fused, typically to the N- or C-terminus, of a core component of
#=GF CC   a biological conflict system; examples include VMAP, iSTAND, or
#=GF CC   GAP1. Further copies of the same EAD are fused to either
#=GF CC   effector or signal-transducing domains, or additional EADs. EAD
#=GF CC   pairs are frequently observed together on the genome in
#=GF CC   conserved gene neighborhoods, but can also be severed from such
#=GF CC   neighborhoods and located in distant regions, indicating the
#=GF CC   EAD-EAD coupling approximates the advantages of collinear
#=GF CC   transcription. Profile-profile searches unify EAD6 with the
#=GF CC   Death superfamily of domains [2].
#=GF SQ   2
#=GS W6FSX1_NODSP/1-76     AC W6FSX1.1
#=GS W6FT03_NODSP/146-221  AC W6FT03.1
W6FSX1_NODSP/1-76                MELSDNQRKELIKIVHKVFEEEELKTICLNNQQILHGNPYSKIQGNTISNRLNYLVDYLIRKKLVDDFLALCLKDS
W6FT03_NODSP/146-221             IRWNDQKRQELLKIVHKVFEEEELKTICLNNQELLHGNPYSKIQGNTVSSRLNYLVDYLIRKNSIQSFLEILSKES
#=GC seq_cons                    hchsDppRpELlKIVHKVFEEEELKTICLNNQplLHGNPYSKIQGNTlSsRLNYLVDYLIRKp.lpsFLtlh.K-S
//