#=GF ID   ExoU_mid_dom
#=GF AC   PF20848.1
#=GF DE   ExoU toxin, middle helical domain
#=GF AU   Lazaro Pinto Beatriz;0000-0001-6837-2941
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF AU   Chuguransky S;0000-0002-0520-0736
#=GF SE   ECOD:3616.1.1
#=GF GA   27.00 27.00;
#=GF TC   27.50 64.70;
#=GF NC   25.20 21.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 -Z 75585367 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RC   Paper describing PDB structure 3tu3
#=GF RN   [1]
#=GF RM   23166655
#=GF RT   Structure of the type III secretion effector protein ExoU in
#=GF RT   complex with its chaperone SpcU.
#=GF RA   Halavaty AS, Borek D, Tyson GH, Veesenmeyer JL, Shuvalova L,
#=GF RA   Minasov G, Otwinowski Z, Hauser AR, Anderson WF;
#=GF RL   PLoS One. 2012;7:e49388.
#=GF RC   Paper describing PDB structure 4akx
#=GF RN   [2]
#=GF RM   22496657
#=GF RT   Structural basis of cytotoxicity mediated by the type III
#=GF RT   secretion toxin ExoU from Pseudomonas aeruginosa.
#=GF RA   Gendrin C, Contreras-Martel C, Bouillot S, Elsen S, Lemaire D,
#=GF RA   Skoufias DA, Huber P, Attree I, Dessen A;
#=GF RL   PLoS Pathog. 2012;8:e1002637.
#=GF RC   Paper describing PDB structure 4qmk
#=GF RN   [3]
#=GF RM   25505182
#=GF RT   A novel phosphatidylinositol 4,5-bisphosphate binding domain
#=GF RT   mediates plasma membrane localization of ExoU and other
#=GF RT   patatin-like phospholipases.
#=GF RA   Tyson GH, Halavaty AS, Kim H, Geissler B, Agard M, Satchell KJ,
#=GF RA   Cho W, Anderson WF, Hauser AR;
#=GF RL   J Biol Chem. 2015;290:2919-2937.
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   Many pathogenic Gram-negative bacteria use type III secretion
#=GF CC   systems (T3SS) to deliver effector proteins into the host cell
#=GF CC   cytosol and facilitate the infectious process. The effector
#=GF CC   protein ExoU from Pseudomonas aeruginosa, one of the most
#=GF CC   aggressive toxins injected by a T3SS, has four distinct domains.
#=GF CC   The chaperone-binding domain consists of two separate regions, a
#=GF CC   N-terminal region and a middle subdomain (this entry). The
#=GF CC   latter shows a mostly alpha-helical structure [1-3].
#=GF SQ   5
#=GS A0A105T363_9PSED/434-554  AC A0A105T363.1
#=GS A0A105T334_9PSED/476-594  AC A0A105T334.1
#=GS A0A8H9YSJ5_9PSED/431-556  AC A0A8H9YSJ5.1
#=GS G8Q2K0_PSEO1/321-446      AC G8Q2K0.1
#=GS A0A3R8U219_9PSED/416-534  AC A0A3R8U219.1
A0A105T363_9PSED/434-554             .ASVQDAVLAMDDEMFSSVAPALEKLGG.HADILHFRQQAQTSLGSLDAAISEANTA-PSLKLTQKLGAALRNLDALARRPEQIEWLGKQLNVAGNCNFQQLLQSD----LSKHANLSKVLTSAH---aea
A0A105T334_9PSED/476-594             .ASMEEALMALDDEMLTSLSAQ---DPAsAGEVLQFRQQARDAFSQLTVAIVAQNETPAGLKLNDVMRGAFTQLDALASTPERKEWLAKELNHADNADHQQLLSAV----RGQAIE-SPVLKAAVAEM...
A0A8H9YSJ5_9PSED/431-556             h-SLDEAVLAMDDEMLASVQPTLHKDPA.AADVLMFRKSAQQVLKTLDDAIGEANQSQVVLVFTPKISTALRNLDALAQRPEQIDWLARRLNVAGQRNFQQLLQVAARQIASDAVPMSNVIGGAVAEM...
G8Q2K0_PSEO1/321-446                 .ASTEAALLALDDKAFEQLSAKLESDEA.CAEVIAFRRQAQQALPQLKQAIQEANKTFTALEPTPQMHMAIWALDQLADQPGKQEWLAKRLNHDNDPDFVQFLQAAARWDKGASTGISEVTHHAVEEM...
A0A3R8U219_9PSED/416-534             .GSLIEALLSLDEEMLATVAQA-SGAPV.VSDVQAWCTSTRQVLDDLDMAVQALDPS-VSVPMAATVRAVVERLDTLASDEARKARLALELNRYERPGAARLLESL----RGQSVT-SAVLNAALVER...
#=GC seq_cons                        .ASl-EALLALDDEMLuSVussLcpDPA.sADVLtFRpQAQQuLssLDsAIsEANpo.suLchTspl+uAlcsLDALAscPE+pEWLAKcLN+AssssFQQLLQus....+GpulshSsVLsuAVsEM...
//