#=GF ID   Exotox-A_target
#=GF AC   PF09102.14
#=GF DE   Exotoxin A, targeting
#=GF AU   Sammut SJ;0000-0003-4472-904X
#=GF SE   pdb_1ikp
#=GF GA   25.00 25.00;
#=GF TC   29.00 238.00;
#=GF NC   23.60 21.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch --cpu 4 -E 1000 -Z 75585367 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   11734000
#=GF RT   Refined crystallographic structure of Pseudomonas aeruginosa
#=GF RT   exotoxin A and its implications for the molecular mechanism of
#=GF RT   toxicity. 
#=GF RA   Wedekind JE, Trame CB, Dorywalska M, Koehl P, Raschke TM, McKee
#=GF RA   M, FitzGerald D, Collier RJ, McKay DB; 
#=GF RL   J Mol Biol. 2001;314:823-837.
#=GF DR   INTERPRO; IPR015186;
#=GF DR   SCOP; 1ikp; fa;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   Members of this family are found in Pseudomonas aeruginosa
#=GF CC   exotoxin A, and are responsible for transmembrane targeting of
#=GF CC   the toxin, as well as transmembrane translocation of the
#=GF CC   catalytic domain into the cytoplasmic compartment. A furin
#=GF CC   cleavage site is present within the domain: cleavage generates a
#=GF CC   37 kDa carboxy-terminal fragment, which includes the enzymatic
#=GF CC   domain, which is then is translocated into the cytoplasm. The
#=GF CC   domain adopts a helical structure, with six alpha-helices
#=GF CC   forming a bundle [1].
#=GF SQ   3
#=GS TOXA_PSEAE/277-409        AC P11439.2
#=GS A0A0X8GM05_9BURK/314-455  AC A0A0X8GM05.1
#=GS A0A0J6NSS9_9NEIS/262-403  AC A0A0J6NSS9.1
TOXA_PSEAE/277-409                   EGGSLAALTAHQACHLPLETFTRHRQPRGWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNALAS-PGSG-------GDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAASADVVSLTCPVAAGECAGP-AD.
A0A0X8GM05_9BURK/314-455             KENALGALSAHRVCGIPLESLARSRQPRGWEELSACGFRVENIVGLYIATRLSFDRFRQVVEDLIHSRPVSGAQDPVALEQLGSVVRETPELAREGLAEAEARLNAYRANHPGSSADDAQRADVLSLTCPADSAPCNAPDA-a
A0A0J6NSS9_9NEIS/262-403             KENALGALSAHRVCGIPLESLARSRQPRGWEELSACGFRVENIVGLYIATRLSFDRFRQVVDDLIHSRPVSGAQDPEALAQLGTAVRETPEMAREGLAEAEARLNAYRANHAGASADDAQRADVLSLTCPADSEPCAAANAD.
#=GC seq_cons                        KENALGALSAHRVCGIPLESLARSRQPRGWEELSACGFRVENIVGLYIATRLSFDRFRQVV-DLIHSRPVSGAQDP.ALuQLGoAVRETPEhAREGLAEAEARLNAYRANHsGuSADDAQRADVLSLTCPADSuPCAAPsAD.
//