#=GF ID   FPRL1_inhibitor
#=GF AC   PF16104.9
#=GF DE   Formyl peptide receptor-like 1 inhibitory protein
#=GF AU   Chang Y;0000-0002-2418-3433
#=GF SE   Jackhmmer JCSG target SP18383A
#=GF GA   27.00 27.00;
#=GF TC   29.50 236.30;
#=GF NC   26.10 21.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 --cpu 4 -E 1000 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   17114475
#=GF RT   A new staphylococcal anti-inflammatory protein that  antagonizes
#=GF RT   the formyl peptide receptor-like 1.
#=GF RA   Prat C, Bestebroer J, de Haas CJ, van Strijp JA,  van Kessel KP;
#=GF RL   J Immunol. 2006 Dec 1;177(11):8017-26.
#=GF DR   INTERPRO; IPR023256;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family consists of several formyl peptide receptor-like 1
#=GF CC   inhibitory proteins from Staphylococcus aureus. These are
#=GF CC   secreted proteins that block the formyl peptide receptor-like 1
#=GF CC   found in neutrophils, monocytes, B cells, and NK cells; and
#=GF CC   inhibit the binding of chemoattractants (such as formylated
#=GF CC   peptides) to FPRL1, which initiate phagocyte mobilization
#=GF CC   towards the infection site [1].
#=GF SQ   1
#=GS FLIPR_STAA8/29-133  AC Q2FZC0.1
FLIPR_STAA8/29-133             FFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSITWY
#=GC seq_cons                  FFSYEWKGLEIAKNLADQAKKDDERIDKLMKESDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGGPRDYYTFDLTRPLEENRKNIKVVKNGEIDSITWY
//