#=GF ID   Flu_B_NS1
#=GF AC   PF02942.18
#=GF DE   Influenza B non-structural protein (NS1)
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_198 (Release 6.4)
#=GF GA   25.00 25.00;
#=GF TC   25.10 515.50;
#=GF NC   24.80 20.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch --cpu 4 -Z 75585367 -E 1000 HMM pfamseq
#=GF TP   Family
#=GF CL   CL0600
#=GF RN   [1]
#=GF RM   11157743
#=GF RT   Influenza B virus NS1 protein inhibits conjugation of the
#=GF RT   interferon (IFN)-induced ubiquitin-like ISG15 protein. 
#=GF RA   Yuan W, Krug RM; 
#=GF RL   EMBO J 2001;20:362-371.
#=GF DR   INTERPRO; IPR004208;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   A specific region of the influenza B virus NS1 protein, which
#=GF CC   includes part of its effector domain, blocks the covalent
#=GF CC   linkage of ISG15 Swiss:Q64339 to its target proteins both in
#=GF CC   vitro and in infected cells. Of the several hundred proteins
#=GF CC   induced by interferon (IFN) alpha/beta, the ubiquitin-like ISG15
#=GF CC   protein is one of the most predominant. Influenza A virus
#=GF CC   employs a different strategy: its NS1 protein does not bind the
#=GF CC   ISG15 protein, but little or no ISG15 protein is produced during
#=GF CC   infection [1].
#=GF SQ   2
#=GS NS1_INBLE/1-247         AC P03502.1
#=GS A0A172SN46_9INFB/1-247  AC A0A172SN46.1
NS1_INBLE/1-247                    MADNMTTTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPYCVKNPSTSKCPNYDWTDYPPTPGKYLDDIEEEPENVDHPIEVVLRDMNNKDARQKIKDEVNTQKEGKFRLTIKRDIRNVLSLRVLVNGTFLKHPNGDKSLSTLHRLNAYDQNGGLVAKLVATDDRTVEDEKDGHRILNSLFERF
A0A172SN46_9INFB/1-247             MADNMTTTQIEVGPGATNATINFEAGILECYERLSWQRALDYPGQDRLNRLKRKLESRIKTHNKSEPESKRMSLEERKAIGVKMMKVLLFMNPSAGIEGFEPYCMKSSSKSNCPKYSWIDYPSTPGRCLDDIEEEPDDVDGPTEIVLRDMNNKDARQKIKEEVNTQKEGKFRLTIKRDMRNVLSLRVLVNGTFLKHPNGYKSLSTLHRLNAYDQSGRLVAKLVATDDLTVEDEEDGYRILNSLFERL
#=GC seq_cons                      MADNMTTTQIEVGPGATNATINFEAGILECYERhSWQRALDYPGQDRLpRLKRKLESRIKTHNKSEPEsKRMSLEERKAIGVKMMKVLLFMsPSAGIEGFEPYChKssSpSpCPpYsWhDYPsTPG+hLDDIEEEP-sVDtPhElVLRDMNNKDARQKIK-EVNTQKEGKFRLTIKRDhRNVLSLRVLVNGTFLKHPNG.KSLSTLHRLNAYDQsGtLVAKLVATDDhTVEDEcDGaRILNSLFERh
//