#=GF ID   HCV_NS5a_1a
#=GF AC   PF08300.17
#=GF DE   Hepatitis C virus non-structural 5a zinc finger domain
#=GF AU   Paterson M;
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Bateman A
#=GF GA   25.00 25.00;
#=GF TC   25.50 96.70;
#=GF NC   24.90 22.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 --cpu 4 -Z 75585367 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   9710605
#=GF RT   Control of PKR protein kinase by hepatitis C virus nonstructural
#=GF RT   5A protein: molecular mechanisms of kinase regulation. 
#=GF RA   Gale M Jr, Blakely CM, Kwieciszewski B, Tan SL, Dossett M, Tang
#=GF RA   NM, Korth MJ, Polyak SJ, Gretch DR, Katze MG; 
#=GF RL   Mol Cell Biol 1998;18:5208-5218.
#=GF RN   [2]
#=GF RM   9143277
#=GF RT   Evidence that hepatitis C virus resistance to interferon is
#=GF RT   mediated through repression of the PKR protein kinase by the
#=GF RT   nonstructural 5A protein. 
#=GF RA   Gale MJ Jr, Korth MJ, Tang NM, Tan SL, Hopkins DA, Dever TE,
#=GF RA   Polyak SJ, Gretch DR, Katze MG; 
#=GF RL   Virology 1997;230:217-227.
#=GF RN   [3]
#=GF RM   15902263
#=GF RT   Structure of the zinc-binding domain of an essential component
#=GF RT   of the hepatitis C virus replicase. 
#=GF RA   Tellinghuisen TL, Marcotrigiano J, Rice CM; 
#=GF RL   Nature 2005;435:374-379.
#=GF DR   INTERPRO; IPR013192;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   The molecular function of the non-structural 5a protein is
#=GF CC   uncertain.  The NS5a protein is phosphorylated when expressed in
#=GF CC   mammalian cells.  It is thought to interact with the ds RNA
#=GF CC   dependent (interferon inducible) kinase PKR, Swiss:P19525 [1,2].
#=GF CC   This domain corresponds to the N-terminal zinc binding domain
#=GF CC   [3].
#=GF SQ   2
#=GS POLG_HCV77/2006-2067    AC P27958.3
#=GS O41892_PEGIA/1972-2025  AC O41892.1
POLG_HCV77/2006-2067               IPFVSCQRGYRGVWRGDGIMHTRCHCGAEITGHVKNGTMRIVGPRTCKNMWSGTFFINAYTT..
O41892_PEGIA/1972-2025             IPLMGCSKGWAGPWEGNGHVEARCTCGCVITGEIYDGELH--------DMVYSTFFCSHY--lr
#=GC seq_cons                      IPhhuCp+GatGsWcGsGhhcsRCpCGs.ITGclhsGph+........sMh.uTFFhstY....
//