GenomeNet

Database: Pfam
Entry: His_Me_b4a2
LinkDB: His_Me_b4a2
Original site: His_Me_b4a2 
#=GF ID   His_Me_b4a2
#=GF AC   PF18275.5
#=GF DE   His-Me finger endonuclease beta4-alpha2 domain
#=GF AU   Smart A;0000-0002-6965-5633
#=GF SE   ECOD:EUF03014
#=GF GA   25.00 25.00;
#=GF TC   114.30 114.30;
#=GF NC   24.40 19.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 --cpu 4 -Z 75585367 HMM pfamseq
#=GF TP   Domain
#=GF CL   CL0263
#=GF RN   [1]
#=GF RM   19380375
#=GF RT   Crystal structure of the beta beta alpha-Me type II restriction
#=GF RT   endonuclease Hpy99I with target DNA.
#=GF RA   Sokolowska M, Czapinska H, Bochtler M;
#=GF RL   Nucleic Acids Res. 2009;37:3799-3810.
#=GF DR   INTERPRO; IPR041475;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This domain is found in Hpy991 present in Helicobacter pylori.
#=GF CC   Hpy991 is a beta-beta-alpha-Me restriction endonuclease that
#=GF CC   recognizes the CGWCG target sequence and cleaves both DNA
#=GF CC   strands with a stagger that leads to 5'-recessed ends in the
#=GF CC   cleavage products. This domain is the first of two beta4-alpha2
#=GF CC   repeats found after the N-terminal domain. The two repeats have
#=GF CC   low overall sequence similarity but readily identified by a
#=GF CC   structural comparison. Both repeats contain contains two CXXC
#=GF CC   motifs that map to the first beta-hairpin and the first
#=GF CC   alpha-helix. The four cysteine residues coordinate a
#=GF CC   structurally bound Zn2+ ion tetrahedrally. The major groove is
#=GF CC   in contact with the first repeat, with the beta-hairpin 2
#=GF CC   inserting deeply into the groove [1].
#=GF SQ   3
#=GS V8C7I2_9HELI/55-106      AC V8C7I2.1
#=GS A0A4U7NDG2_9SPIR/56-107  AC A0A4U7NDG2.1
#=GS I7HE83_9HELI/56-107      AC I7HE83.1
V8C7I2_9HELI/55-106                 DIYKTGKGYDKKICNICHILKDTDDFEINQTDAKGRKTTRPSCRECRKNIDG
A0A4U7NDG2_9SPIR/56-107             DIYKTGKGYKNKICNICHILKPTDEFEINQTDAKGIKTTRPSCRECRKTIDG
I7HE83_9HELI/56-107                 DIYKTGKGFDCKICNICHILKDTGSFEINQTDAKGNKTTRPSCRECRKHIDG
#=GC seq_cons                       DIYKTGKGYDsKICNICHILKDTD-FEINQTDAKGpKTTRPSCRECRKsIDG
//
DBGET integrated database retrieval system