#=GF ID   MPS-4
#=GF AC   PF17523.6
#=GF DE   MinK-related peptide, potassium channel accessory sub-unit protein 4
#=GF AU   El-Gebali S;0000-0003-1378-5495
#=GF SE   PRODOM:PD064148
#=GF GA   25.00 25.00;
#=GF TC   157.30 157.20;
#=GF NC   24.10 24.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12533541
#=GF RT   A potassium channel-MiRP complex controls neurosensory function
#=GF RT   in Caenorhabditis elegans.
#=GF RA   Bianchi L, Kwok SM, Driscoll M, Sesti F;
#=GF RL   J Biol Chem. 2003;278:12415-12424.
#=GF RN   [2]
#=GF RM   25347290
#=GF RT   Solution NMR of MPS-1 reveals a random coil cytosolic domain
#=GF RT   structure.
#=GF RA   Li P, Shi P, Lai C, Li J, Zheng Y, Xiong Y, Zhang L, Tian C;
#=GF RL   PLoS One. 2014;9:e111035.
#=GF DR   INTERPRO; IPR020383;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   MinK-related peptides (MiRPs or KCNEs) are single-transmembrane
#=GF CC   proteins that associate with pore-forming ion-channel sub-units
#=GF CC   to form stable complexes with channel properties markedly
#=GF CC   distinct from those of the isolated pore-forming sub-units [1].
#=GF CC   MPS-4 is expressed exclusively in the C. elegans nervous system
#=GF CC   and is essential for neuronal excitability [2].
#=GF SQ   2
#=GS MPS4_CAEEL/1-78    AC P34394.1
#=GS A8XP81_CAEBR/1-77  AC A8XP81.1
MPS4_CAEEL/1-78               MTFPKENINNYASSSFNYKYLIEEFLQWSSSCNRISYPTKYFDFLLVIIMTFVFLCLVYLLIWIEVLLNSSRPDPKHR
A8XP81_CAEBR/1-77             MSTPREN-DNYASSSPIFKPLLHEFLKRSSSCNRISFSTQYFDFLLIVTISVFSFGAIFLILWADFLLNSVRPGSRKR
#=GC seq_cons                 MohP+EN.sNYASSS..aK.LlcEFLphSSSCNRISasTpYFDFLLllhhohh.hshlaLllWh-hLLNSsRPss++R
//