#=GF ID NS1_C
#=GF AC PF12117.12
#=GF DE Parvovirus non-structural protein 1, C-terminal
#=GF PI DUF_B2046; DUF3580;
#=GF AU Assefa S;0000-0003-2178-533X
#=GF AU Bateman A;0000-0002-6982-4660
#=GF AU Coggill P;0000-0001-5731-1588
#=GF AU Chuguransky S;0000-0002-0520-0736
#=GF SE PFAM-B_2046 (release 23.0)
#=GF GA 25.00 25.00;
#=GF TC 25.70 272.10;
#=GF NC 24.10 20.30;
#=GF BM hmmbuild HMM.ann SEED.ann
#=GF SM hmmsearch -E 1000 -Z 75585367 --cpu 4 HMM pfamseq
#=GF TP Domain
#=GF RN [1]
#=GF RM 7799962
#=GF RT Transcriptional activation by the parvoviral nonstructural
#=GF RT protein NS-1 is mediated via a direct interaction with Sp1.
#=GF RA Krady JK, Ward DC;
#=GF RL Mol Cell Biol. 1995;15:524-533.
#=GF RN [2]
#=GF RM 9847309
#=GF RT A novel heterogeneous nuclear ribonucleoprotein-like protein
#=GF RT interacts with NS1 of the minute virus of mice.
#=GF RA Harris CE, Boden RA, Astell CR;
#=GF RL J Virol. 1999;73:72-80.
#=GF RN [3]
#=GF RM 20097398
#=GF RT Determination and analysis of the full-length chicken parvovirus
#=GF RT genome.
#=GF RA Day JM, Zsak L;
#=GF RL Virology. 2010;399:59-64.
#=GF RN [4]
#=GF RM 12050365
#=GF RT Parvovirus initiator protein NS1 and RPA coordinate replication
#=GF RT fork progression in a reconstituted DNA replication system.
#=GF RA Christensen J, Tattersall P;
#=GF RL J Virol. 2002;76:6518-6531.
#=GF DR INTERPRO; IPR021972;
#=GF DR SO; 0000417; polypeptide_domain;
#=GF CC This domain is the transactivation domain of the Parvovirus NS1
#=GF CC protein, located immediately C-terminal to the helicase [1,2].
#=GF CC Parvovirus are some of the smallest viruses containing linear,
#=GF CC non-segmented single-stranded DNA genomes, with an average
#=GF CC genome size of 5000 nucleotides. They infect a wide range of
#=GF CC invertebrates and vertebrates and are well known for causing
#=GF CC enteric disease in mammals. Genomes contain two large ORFs: NS1
#=GF CC and VP1; other ORFs are found in some sub-types and different
#=GF CC gene products can arise from splice variants and the use of
#=GF CC different start codons [3]. NS1 protein is essential for viral
#=GF CC life cycle stages, including DNA replication, trans-regulation
#=GF CC of the two viral promoters and modulation of heterologous
#=GF CC promoters. It exhibits DNA binding, endonuclease and helicase
#=GF CC activities and is the major contributor to the toxic effect on
#=GF CC host cells [4].
#=GF SQ 2
#=GS NS1_MUMIP/552-672 AC P03134.1
#=GS Q84365_MUMIP/601-721 AC Q84365.1
NS1_MUMIP/552-672 AKWGKVPDWSENWAEPKVPTPINLLGSARSPFTTPKSTPLSQNYALTPLASDLEDLALEPWSTPNTPVAGTAETQNTGEAGSKACQDGQLSPTWSEIEEDLRACFGAEPLKKDFSEPLNLD
Q84365_MUMIP/601-721 AKWGKVPDWSENWAEPKVPTPINLLGSARSPFTTPKSTPLSQNYALTPLASDLEDLALEPWSTPNTPVAGTAETQNTGEAGSKACQDGQLSPTWSEIEEDLRACFGAEPLKKDFSEPLNLD
#=GC seq_cons AKWGKVPDWSENWAEPKVPTPINLLGSARSPFTTPKSTPLSQNYALTPLASDLEDLALEPWSTPNTPVAGTAETQNTGEAGSKACQDGQLSPTWSEIEEDLRACFGAEPLKKDFSEPLNLD
//
