#=GF ID   Novirhabdo_Nv
#=GF AC   PF05554.15
#=GF DE   Viral hemorrhagic septicemia virus non-virion protein
#=GF AU   Moxon SJ;0000-0003-4644-1816
#=GF SE   Pfam-B_7684 (release 8.0)
#=GF GA   25.00 25.00;
#=GF TC   28.80 249.60;
#=GF NC   23.30 20.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   7571446
#=GF RT   Distant strains of the fish rhabdovirus VHSV maintain a sixth
#=GF RT   functional cistron which codes for a nonstructural protein of
#=GF RT   unknown function. 
#=GF RA   Basurco B, Benmansour A; 
#=GF RL   Virology 1995;212:741-745.
#=GF DR   INTERPRO; IPR008720;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family consists of several viral hemorrhagic septicemia
#=GF CC   virus non-virion (Nv) proteins. The NV protein is a
#=GF CC   nonstructural protein absent from mature virions although it is
#=GF CC   present in infected cells. The function of this protein is
#=GF CC   unknown [1].
#=GF SQ   1
#=GS Q08489_9RHAB/1-122  AC Q08489.1
Q08489_9RHAB/1-122             MATQPALSTTSFSPLVLREMITHRLKFDPSNYLNCDLDRSDISPVDFFETTLPRILDDLRASTRLPHLHVLDMRISLLERTHYMFRNVPSSPATTGRLTDPELVIISHAEVGLLTRGSGLPS
#=GC seq_cons                  MATQPALSTTSFSPLVLREMITHRLKFDPSNYLNCDLDRSDISPVDFFETTLPRILDDLRASTRLPHLHVLDMRISLLERTHYMFRNVPSSPATTGRLTDPELVIISHAEVGLLTRGSGLPS
//