#=GF ID PAZ_4
#=GF AC PF18349.5
#=GF DE PAZ domain
#=GF PI Paz_1;
#=GF AU El-Gebali S;0000-0003-1378-5495
#=GF SE ECOD:EUF03966
#=GF GA 25.00 25.00;
#=GF TC 30.50 206.70;
#=GF NC 24.10 23.70;
#=GF BM hmmbuild HMM.ann SEED.ann
#=GF SM hmmsearch -Z 75585367 --cpu 4 -E 1000 HMM pfamseq
#=GF TP Domain
#=GF CL CL0010
#=GF RN [1]
#=GF RM 16061186
#=GF RT Crystal structure of A. aeolicus argonaute, a site-specific
#=GF RT DNA-guided endoribonuclease, provides insights into
#=GF RT RISC-mediated mRNA cleavage.
#=GF RA Yuan YR, Pei Y, Ma JB, Kuryavyi V, Zhadina M, Meister G, Chen
#=GF RA HY, Dauter Z, Tuschl T, Patel DJ;
#=GF RL Mol Cell. 2005;19:405-419.
#=GF RN [2]
#=GF RM 17027504
#=GF RT A potential protein-RNA recognition event along the RISC-loading
#=GF RT pathway from the structure of A. aeolicus Argonaute with
#=GF RT externally bound siRNA.
#=GF RA Yuan YR, Pei Y, Chen HY, Tuschl T, Patel DJ;
#=GF RL Structure. 2006;14:1557-1565.
#=GF RN [3]
#=GF RM 17130125
#=GF RT Structure of Aquifex aeolicus argonaute highlights
#=GF RT conformational flexibility of the PAZ domain as a potential
#=GF RT regulator of RNA-induced silencing complex function.
#=GF RA Rashid UJ, Paterok D, Koglin A, Gohlke H, Piehler J, Chen JC;
#=GF RL J Biol Chem. 2007;282:13824-13832.
#=GF DR INTERPRO; IPR041659;
#=GF DR SO; 0000417; polypeptide_domain;
#=GF CC This is a Paz domain found in Argonaute proteins from Aquifex
#=GF CC aeolicus bacteria. The PAZ core fold in Aquifex aeolicus
#=GF CC bacteria Ago (Aa-Ago) proteins is closely related to the human
#=GF CC hAgo1 PAZ domain [1]. Structural and functional studies of
#=GF CC Aa-Ago indicate that conformational rearrangement of the PAZ
#=GF CC domain may be critical for the catalytic cycle of Argonaute and
#=GF CC the RNA-induced silencing complex [3].
#=GF SQ 1
#=GS O67434_AQUAE/167-259 AC O67434.1
O67434_AQUAE/167-259 ETLQTLLERNDFNPKRIRVKPIGIDFVGRVQDVFKAKEKGEEFFRLCMERSTHKSSKKAWEELLKNRELREKAFLVVLEKGYTYPATILKPVL
#=GC seq_cons ETLQTLLERNDFNPKRIRVKPIGIDFVGRVQDVFKAKEKGEEFFRLCMERSTHKSSKKAWEELLKNRELREKAFLVVLEKGYTYPATILKPVL
//
