#=GF ID   Peptidase_A3B
#=GF AC   PF21024.1
#=GF DE   Peptidase A3B
#=GF AU   Chuguransky S;0000-0002-0520-0736
#=GF SE   Prosite (PS51817)
#=GF GA   28.20 28.20;
#=GF TC   28.20 139.60;
#=GF NC   27.80 26.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 --cpu 4 -Z 75585367 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   15831103
#=GF RT   Characterization of the protease domain of Rice tungro
#=GF RT   bacilliform virus responsible for the processing of the capsid
#=GF RT   protein from the polyprotein.
#=GF RA   Marmey P, Rojas-Mendoza A, de Kochko A, Beachy RN, Fauquet CM;
#=GF RL   Virol J. 2005;2:33.
#=GF RN   [2]
#=GF RM   7674916
#=GF RT   Families of aspartic peptidases, and those of unknown catalytic
#=GF RT   mechanism.
#=GF RA   Rawlings ND, Barrett AJ;
#=GF RL   Methods Enzymol. 1995;248:105-120.
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This entry includes the aspartic peptidase domain from the P3
#=GF CC   polyprotein of Pararetroviruses (such as rice tungro bacilliform
#=GF CC   virus), a member of the family Caulimoviridae. P3 contains a
#=GF CC   putative movement protein (MP), the capsid protein (CP), the
#=GF CC   aspartate protease (PR) and the reverse transcriptase (RT) with
#=GF CC   a ribonuclease H activity. PR proteolytically processes P3. The
#=GF CC   sequence DSGS is believed to be the RTBV protease active site
#=GF CC   [1]. The RTBV PR domain forms peptidase family A3 subfamily B
#=GF CC   [2].
#=GF SQ   3
#=GS A0A2R6R8L0_ACTCC/478-573  AC A0A2R6R8L0.1
#=GS POL_RTBVP/983-1077        AC P27502.1
#=GS A0A251RXY7_HELAN/19-114   AC A0A251RXY7.1
A0A2R6R8L0_ACTCC/478-573             LGLVDTGCTSCIINKKLIPDYLCKKSDRIIQGQQMDGKLHSYDTELVPGAMISFKTNRDQFSTEYTLPQTWVRNlN..VSSDFIIGLTFLLNQNGGI-f
POL_RTBVP/983-1077                   TALIDSGSTHNIICPTLIPASWINNTHREIIMFAVDNSKYNLNQELIDDIKLQFQEVDETFGIKYKLGQTYVAP.K..PTKTFIIGHRFLTNENGSVT.
A0A251RXY7_HELAN/19-114              TALVDTRATKSLISHSLVPEQYHKELKYKVVSRTIENRLVGITH-YLEPTGIQFLDFTNNYSIKYDIPQVNINP.AyiQSKDFVLGLNFLFALNGSVT.
#=GC seq_cons                        TALVDTGuT+sIIs+oLIP-papKco+RcIlupslDN+LaulspELl-sstIQFp-sc-sFSIKYcLPQTaVsP.s..sSKDFIIGLsFLhNpNGSVT.
//