GenomeNet

Database: Pfam
Entry: Peptidase_C28
LinkDB: Peptidase_C28
Original site: Peptidase_C28 
#=GF ID   Peptidase_C28
#=GF AC   PF05408.15
#=GF DE   Foot-and-mouth virus L-proteinase
#=GF AU   Studholme DJ;0000-0002-3010-6637
#=GF SE   Manual
#=GF GA   27.00 27.00;
#=GF TC   479.90 478.60;
#=GF NC   20.60 19.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 --cpu 4 -E 1000 HMM pfamseq
#=GF TP   Family
#=GF CL   CL0125
#=GF RN   [1]
#=GF RM   12297280
#=GF RT   Foot-and-mouth disease virus leader proteinase: a papain-like
#=GF RT   enzyme requiring an acidic environment in the active site. 
#=GF RA   Kronovetr J, Skern T; 
#=GF RL   FEBS Lett 2002;528:58-62.
#=GF DR   INTERPRO; IPR008739;
#=GF DR   MEROPS; C28;
#=GF DR   SCOP; 1qol; fa;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Corresponds to Merops family C28. Protein fold of the peptidase
#=GF CC   unit for members of this family resembles that of papain. The
#=GF CC   leader proteinase of foot and mouth disease virus (FMDV) cleaves
#=GF CC   itself from the growing polyprotein and also cleaves the host
#=GF CC   translation initiation factor 4GI (eIF4G), thus inhibiting
#=GF CC   5'-cap dependent translation.
#=GF SQ   1
#=GS Q9DLK1_FMDVP/1-201  AC Q9DLK1.1
Q9DLK1_FMDVP/1-201             MNTTDCFIALLYALREIKALFLSRTQGKMEFTLYNGEKKVFYSRPNNHDNCWLNAILQLFRYVDEPFLEWVYDSPENLTLEAINKLEEITGLELHEGGPPALVVWNIKHLLYTGIGTASRPSEVCMVDGTDMCLADFHAGIFLKGQDHAVFACVTSDGWYAIDDEDFYPWTPNPADVLVFVPYDQEPFNAEWKAKVQKRLR
#=GC seq_cons                  MNTTDCFIALLYALREIKALFLSRTQGKMEFTLYNGEKKVFYSRPNNHDNCWLNAILQLFRYVDEPFLEWVYDSPENLTLEAINKLEEITGLELHEGGPPALVVWNIKHLLYTGIGTASRPSEVCMVDGTDMCLADFHAGIFLKGQDHAVFACVTSDGWYAIDDEDFYPWTPNPADVLVFVPYDQEPFNAEWKAKVQKRLR
//
DBGET integrated database retrieval system