GenomeNet

Database: Pfam
Entry: Peptidase_C53
LinkDB: Peptidase_C53
Original site: Peptidase_C53 
#=GF ID   Peptidase_C53
#=GF AC   PF05550.15
#=GF DE   Pestivirus Npro endopeptidase C53
#=GF AU   Studholme DJ;0000-0002-3010-6637
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF SE   Merops
#=GF GA   27.00 27.00;
#=GF TC   33.20 395.80;
#=GF NC   24.30 20.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 --cpu 4 -Z 75585367 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   11711606
#=GF RT   Functional specialization and evolution of leader proteinases in
#=GF RT   the family Closteroviridae. 
#=GF RA   Peng CW, Peremyslov VV, Mushegian AR, Dawson WO, Dolja VV; 
#=GF RL   J Virol 2001;75:12153-12160.
#=GF RN   [2]
#=GF RM   10864644
#=GF RT   Generation and characterization of a hepatitis C virus NS3
#=GF RT   protease-dependent bovine viral diarrhea virus. 
#=GF RA   Lai VC, Zhong W, Skelton A, Ingravallo P, Vassilev V, Donis RO,
#=GF RA   Hong Z, Lau JY; 
#=GF RL   J Virol 2000;74:6339-6347.
#=GF RN   [3]
#=GF RM   9499122
#=GF RT   N-terminal protease of pestiviruses: identification of putative
#=GF RT   catalytic residues by site-directed mutagenesis. 
#=GF RA   Rumenapf T, Stark R, Heimann M, Thiel HJ; 
#=GF RL   J Virol 1998;72:2544-2547.
#=GF RN   [4]
#=GF RM   8972567
#=GF RT   Expression in E. coli and purification of the active
#=GF RT   autoprotease P20 of classical swine fever virus. 
#=GF RA   Muyldermans G, San Gabriel MC, Hamers R, Wyns L; 
#=GF RL   Virus Genes 1996;13:135-142.
#=GF DR   INTERPRO; IPR008751;
#=GF DR   MEROPS; C53;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   Unique to pestiviruses, the N-terminal protein encoded by the
#=GF CC   bovine viral diarrhoea virus genome is a cysteine protease
#=GF CC   (Npro) responsible for  a self-cleavage that releases the N
#=GF CC   terminus of the core protein.  This unique protease is
#=GF CC   dispensable for viral replication, and its  coding region can be
#=GF CC   replaced by a ubiquitin gene directly fused in frame to the
#=GF CC   core. 
#=GF SQ   1
#=GS POLG_BVDVN/1-168  AC P19711.2
POLG_BVDVN/1-168             MELITNELLYKTYKQKPVGVEEPVYDQAGDPLFGERGAVHPQSTLKLPHKRGERDVPTNLASLPKRGDCRSGNSRGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYVCIDGCIIIKSATRSYQRVFRWVHNRLDCPLWVTTC
#=GC seq_cons                MELITNELLYKTYKQKPVGVEEPVYDQAGDPLFGERGAVHPQSTLKLPHKRGERDVPTNLASLPKRGDCRSGNSRGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYVCIDGCIIIKSATRSYQRVFRWVHNRLDCPLWVTTC
//
DBGET integrated database retrieval system