GenomeNet

Database: Pfam
Entry: Pertus-S5-tox
LinkDB: Pertus-S5-tox
Original site: Pertus-S5-tox 
#=GF ID   Pertus-S5-tox
#=GF AC   PF09276.14
#=GF DE   Pertussis toxin S5 subunit 
#=GF AU   Sammut SJ;0000-0003-4472-904X
#=GF SE   pdb_1prt
#=GF GA   25.00 25.00;
#=GF TC   225.70 225.50;
#=GF NC   21.70 19.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Pertussis_toxin
#=GF CL   CL0658
#=GF RN   [1]
#=GF RM   8075982
#=GF RT   The crystal structure of pertussis toxin. 
#=GF RA   Stein PE, Boodhoo A, Armstrong GD, Cockle SA, Klein MH, Read RJ; 
#=GF RL   Structure. 1994;2:45-57.
#=GF DR   INTERPRO; IPR015356;
#=GF DR   SCOP; 1prt; fa;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   Members of this family of Bordetella pertussis toxins adopt a
#=GF CC   structure consisting of an OB fold, with a closed or partly
#=GF CC   opened beta-barrel in a Greek-key topology [1].
#=GF SQ   1
#=GS TOX5_BORPE/37-133  AC P04981.1
TOX5_BORPE/37-133             PTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE
#=GC seq_cons                 PTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE
//
DBGET integrated database retrieval system