#=GF ID   Phage_Gp17
#=GF AC   PF17549.6
#=GF DE   Gene Product 17
#=GF AU   El-Gebali S;0000-0003-1378-5495
#=GF SE   PRODOM:PD021825
#=GF GA   25.00 25.00;
#=GF TC   28.00 36.10;
#=GF NC   23.40 21.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 -Z 75585367 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   16517096
#=GF RT   Requirements for Bacillus subtilis bacteriophage phi29 DNA
#=GF RT   ejection.
#=GF RA   Gonzalez-Huici V, Salas M, Hermoso JM;
#=GF RL   Gene. 2006;374:19-25.
#=GF DR   INTERPRO; IPR035184;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Family members such as protein 17 (gene product 17/gp17) found
#=GF CC   in Bacillus phage phi29, is involved in DNA replication and in
#=GF CC   pulling the phage DNA into the cell during the injection process
#=GF CC   [1].
#=GF SQ   2
#=GS A0A142IGA1_9CAUD/1-66  AC A0A142IGA1.1
#=GS GP17_BPPH2/1-140       AC P03686.2
A0A142IGA1_9CAUD/1-66             MNNYQLTINEVLDIIKMNTEIVRDIMDNDTSAPA-LHRHGKTKLISTILTYQYDISRITLEL------------------------------------------------------------------------------setak
GP17_BPPH2/1-140                  MNNYQLTINEVIDIINTNTEINKLVAKKENLFPTDLYDLDKQELIAIILNSDFALSSIKRVLLEVTVEELGTQDNDEDDELEDLDGEIDRVDYIDKDGIRFDVPRETSPHVDKSIVTFNDELLDEANKIAKSIQEHDFND.....
#=GC seq_cons                     MNNYQLTINEVlDIIphNTEIs+.lhcp-s.hPs.LachsKpcLIuhILs.paslSpIph.L...................................................................................
//