#=GF ID Phyto-Amp
#=GF AC PF15438.10
#=GF DE Antigenic membrane protein of phytoplasma
#=GF AU Coggill P;0000-0001-5731-1588
#=GF SE Jackhmmer:Q7M1T6
#=GF GA 25.00 25.00;
#=GF TC 165.50 34.40;
#=GF NC 20.40 19.40;
#=GF BM hmmbuild HMM.ann SEED.ann
#=GF SM hmmsearch -Z 75585367 --cpu 4 -E 1000 HMM pfamseq
#=GF TP Family
#=GF RN [1]
#=GF RM 11782508
#=GF RT Immunodominant membrane proteins from two phytoplasmas in the
#=GF RT aster yellows clade (chlorante aster yellows and clover
#=GF RT phyllody) are highly divergent in the major hydrophilic region.
#=GF RA Barbara DJ, Morton A, Clark MF, Davies DL;
#=GF RL Microbiology. 2002;148:157-167.
#=GF RN [2]
#=GF RM 21799902
#=GF RT The major antigenic membrane protein of "Candidatus Phytoplasma
#=GF RT asteris" selectively interacts with ATP synthase and actin of
#=GF RT leafhopper vectors.
#=GF RA Galetto L, Bosco D, Balestrini R, Genre A, Fletcher J, Marzachi
#=GF RA C;
#=GF RL PLoS One. 2011;6:e22571.
#=GF DR INTERPRO; IPR029216;
#=GF DR SO; 0100021; polypeptide_conserved_region;
#=GF CC Phyto-Amp is a family of phytopathogenic wall-less bacterial
#=GF CC antigenic membrane proteins [1]. The bacteria are limited to the
#=GF CC phloem and pose a major threat to agriculture worldwide. They
#=GF CC are transmitted in a persistent, propagative manner by
#=GF CC phloem-sucking Hemipteran insects. Phytoplasma membrane proteins
#=GF CC are in direct contact with hosts and are assumed to be involved
#=GF CC in determining vector specificity. Phyto-Amp is thought to be
#=GF CC one family of proteins that mediates such specificity. The
#=GF CC proteins appear to be encoded by circular extrachromosomal
#=GF CC elements, at least one of which is a plasmid [2].
#=GF SQ 3
#=GS AMP_ONYPE/1-195 AC Q7M1T6.3
#=GS B1VAX3_PHYAS/84-113 AC B1VAX3.1
#=GS B1VAX3_PHYAS/1-88 AC B1VAX3.1
AMP_ONYPE/1-195 ..MQNQKNQKSLVAKVLVLF---AAVALMFVGVQVFADDKLDLNTLECKDALELTAADAADAEKVVKQWKVQNTSLNAKVTKDSVKVAVADNKVTVTPADGDAGKALSGSKILNLVGVCELNKLTLGTEKKLTLTVKDGKVDAEAGLKALKEAGAKVPATVNKDDVTFTVGKDDNANKVTVKAVDGKTTVSGQVVFEFTV.
B1VAX3_PHYAS/84-113 tl--------------------------------------------------------------------------------------------------------------------------------------------------------------------------NDAKTKVTVKAKDNDTVVAGSVELDIKA.
B1VAX3_PHYAS/1-88 ..MNNTKIQKTLVSKLAALFAIGAAVSLLFVS-NVFAAAK-ELNTFKTNQAIAITAENASNVEKVLTAWN--------KV-DDTVKVADLKDHVTVTLND----------------------------------------------------------------------------------------------------a
#=GC seq_cons ..MpNpK.QKoLVuKlhsLF...AAVuLhFVu.pVFAssK.-LNThcsppAltlTAtsAussEKVlptWp........KV.cDoVKVAshcs+VTVT.sD........................................................................sDstsKVTVKAhDscTsVuGpV.h-hps.
//
