#=GF ID   PsaS
#=GF AC   PF21462.1
#=GF DE   Ph 6 antigen
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF AU   Chuguransky S;0000-0002-0520-0736
#=GF SE   ECOD:EF15321
#=GF GA   27.00 27.00;
#=GF TC   31.00 262.00;
#=GF NC   26.30 21.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 --cpu 4 -E 1000 HMM pfamseq
#=GF TP   Domain
#=GF CL   CL0204
#=GF RC   Paper describing PDB structure 4f8l
#=GF RN   [1]
#=GF RM   23277582
#=GF RT   Structural basis for the specific recognition of dual receptors
#=GF RT   by the homopolymeric pH 6 antigen (Psa) fimbriae of Yersinia
#=GF RT   pestis.
#=GF RA   Bao R, Nair MK, Tang WK, Esser L, Sadhukhan A, Holland RL, Xia
#=GF RA   D, Schifferli DM;
#=GF RL   Proc Natl Acad Sci U S A. 2013;110:1065-1070.
#=GF RC   Paper describing PDB structure 5ln4
#=GF RN   [2]
#=GF RM   27507539
#=GF RT   Structural basis for Myf and Psa fimbriae-mediated tropism of
#=GF RT   pathogenic strains  of Yersinia for host tissues.
#=GF RA   Pakharukova N, Roy S, Tuittila M, Rahman MM, Paavilainen S,
#=GF RA   Ingars AK, Skaldin M, Lamminmaki U, Hard T, Teneberg S, Zavialov
#=GF RA   AV;
#=GF RL   Mol Microbiol. 2016;102:593-610.
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This entry represents the ph 6 antigen (also known as adhesin or
#=GF CC   antigen 4) from Yersinia pestis, which is part of fimbriae,
#=GF CC   necessary for full virulence [1,2]. It mediates bacterial
#=GF CC   attachment to alveolar cells of the lung.
#=GF SQ   1
#=GS PSAA_YERPE/47-158  AC P31522.1
PSAA_YERPE/47-158             FHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYINDDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVF
#=GC seq_cons                 FHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYINDDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVF
//