#=GF ID   RTBV_P12
#=GF AC   PF06361.15
#=GF DE   Rice tungro bacilliform virus P12 protein
#=GF AU   Moxon SJ;0000-0003-4644-1816
#=GF SE   Pfam-B_14960 (release 9.0)
#=GF GA   25.00 25.00;
#=GF TC   27.20 250.80;
#=GF NC   23.70 19.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   2041739
#=GF RT   An analysis of the sequence of an infectious clone of rice
#=GF RT   tungro bacilliform virus, a plant pararetrovirus. 
#=GF RA   Hay JM, Jones MC, Blakebrough ML, Dasgupta I, Davies JW, Hull R; 
#=GF RL   Nucleic Acids Res 1991;19:2615-2621.
#=GF DR   INTERPRO; IPR009417;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family consists of several Rice tungro bacilliform virus
#=GF CC   P12 proteins. The function of this family is unknown [1].
#=GF SQ   1
#=GS P2_RTBVP/1-110  AC P27499.1
P2_RTBVP/1-110             MSADYPTFKEALEKFKNLESDTAGKDKFNWVFTLENIKSAADVNLASKGLVQLYALQEIDKKINNLTTQVSKLPTTSGSSSAGAIVPAGSNTQGQYKAPPKKGIKRKYPA
#=GC seq_cons              MSADYPTFKEALEKFKNLESDTAGKDKFNWVFTLENIKSAADVNLASKGLVQLYALQEIDKKINNLTTQVSKLPTTSGSSSAGAIVPAGSNTQGQYKAPPKKGIKRKYPA
//