#=GF ID Reo_sigma1
#=GF AC PF01664.20
#=GF DE Reovirus viral attachment protein sigma 1
#=GF AU Bashton M;0000-0002-6847-1525
#=GF AU Bateman A;0000-0002-6982-4660
#=GF SE Pfam-B_1003 (release 4.1)
#=GF GA 25.00 25.00;
#=GF TC 26.90 349.80;
#=GF NC 22.70 21.70;
#=GF BM hmmbuild HMM.ann SEED.ann
#=GF SM hmmsearch --cpu 4 -E 1000 -Z 75585367 HMM pfamseq
#=GF TP Family
#=GF CL CL0326
#=GF RN [1]
#=GF RM 2335823
#=GF RT Structure of the reovirus cell-attachment protein: a model for
#=GF RT the domain organization of sigma 1.
#=GF RA Nibert ML, Dermody TS, Fields BN;
#=GF RL J Virol 1990;64:2976-2989.
#=GF RN [2]
#=GF RM 2398530
#=GF RT Sequence diversity in S1 genes and S1 translation products of 11
#=GF RT serotype 3 reovirus strains.
#=GF RA Dermody TS, Nibert ML, Bassel-Duby R, Fields BN;
#=GF RL J Virol 1990;64:4842-4850.
#=GF RN [3]
#=GF RM 2305549
#=GF RT Identification of conserved domains in the cell attachment
#=GF RT proteins of the three serotypes of reovirus.
#=GF RA Duncan R, Horne D, Cashdollar LW, Joklik WK, Lee PW;
#=GF RL Virology 1990;174:399-409.
#=GF DR INTERPRO; IPR002592;
#=GF DR SCOP; 1kke; fa;
#=GF DR SO; 0100021; polypeptide_conserved_region;
#=GF CC This family consists of the reovirus sigma 1 hemagglutinin, cell
#=GF CC attachment protein. This glycoprotein is a minor capsid protein
#=GF CC and also determines the serotype-specific humoral immune
#=GF CC response. Sigma 1 consist of a fibrous tail and a globular head.
#=GF CC The head has important roles in the cell attachment function of
#=GF CC sigma 1 and determinant of the type-specific humoral immune
#=GF CC response [2]. Reovirus is part of the orthoreovirus group of
#=GF CC retroviruses with, a dsRNA genome. Also present in this family
#=GF CC is bacteriophage SF6 Lysozyme Swiss:P21270.
#=GF SQ 4
#=GS SIGM1_REOVL/251-469 AC P04506.2
#=GS A0A0B5CUU1_9VIRU/239-454 AC A0A0B5CUU1.1
#=GS SIGM1_REOVJ/244-462 AC P04507.3
#=GS SIGM1_REOVD/239-454 AC P03528.3
SIGM1_REOVL/251-469 INELPSRVSTLESAKIDSVLPPLTVREASGVRTLSFGYDTSDFTIINSVLSLRSRLTLPTYRYPLELDTANNRVQVADRFGMRTGTWTGQLQYQHPQLSWRANVTLNLMKVDDWLVLSFSQMTTNSIMADGKFVINFVSGLSSGWQTGDTEPSST..IDPLSTTFAAVQFLNNGQRIDAFRIMGVSEWTDGELEIKNYGGTYTGHTQVYWAPWTIMYPCNV.
A0A0B5CUU1_9VIRU/239-454 FDSINSRIGAIEQSSVASAVTPLRLNSS--TKVLDMLIDSSTLEIN-SSGQLTVRSTSPNLRYPIADVSGG--IGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHndVVTYGAQTVAIGLSSGGAPQYMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSF.
SIGM1_REOVJ/244-462 ISGLPARTGSLEASRIDVVAPPLVIQSTGSTRLLRLMYEAVDFVVTNNVLTLRNRSVTPTFKFPLELNSADNSVSIHRNYRIRLGQWSGQLEYHTPSLRWNAPVTVNLMRVDDWLILSFTRFSTSGILASGKFVLNFVTGLSPGWATGSTEPSTT..TNPLSTTFAAIQFINGSSRVDAFRILGVAEWNAGELEITNHGGTYTAHTNVDWAPMTIMYPCL-g
SIGM1_REOVD/239-454 FDSINSRIGATEQSYVASAVTPLRLNSS--TKVLDMLIDSSTLEIN-SSGQLTVRSTSPNLRYPIADVSGG--IGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHndVVTYGAQTVAIGLSSGGAPQYMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSF.
#=GC seq_cons hsulsSRlGulEpSplsSslsPLplpSo..T+lLchhhDoSshpIs.SshpLpsRSToPshRYPlt.sSus..luhusNYRhRpuhWhG.lpYpssuLsWRspVssslhhVDDalhlshstFss.SIhsuGchsLNFVTGL.PshhTGDTEPuhp..lsshusphsAIth.sGGu...h.+.LhVppWpDG.Lcl+scGGs.hsHoNscWssMTl.YPpsh.
//
