#=GF ID Reovirus_L2_8th
#=GF AC PF06016.15
#=GF DE Reovirus core-spike protein lambda-2 (L2), C-terminal
#=GF PI Reovirus_L2;
#=GF AU Moxon SJ;0000-0003-4644-1816
#=GF SE Pfam-B_7350 (release 9.0)
#=GF GA 27.00 27.00;
#=GF TC 27.60 42.90;
#=GF NC 25.60 24.70;
#=GF BM hmmbuild HMM.ann SEED.ann
#=GF SM hmmsearch --cpu 4 -Z 75585367 -E 1000 HMM pfamseq
#=GF TP Domain
#=GF CL CL0159
#=GF RN [1]
#=GF RM 11531411
#=GF RT Mammalian reovirus L2 gene and lambda2 core spike protein
#=GF RT sequences and whole-genome comparisons of reoviruses type 1
#=GF RT Lang, type 2 Jones, and type 3 Dearing.
#=GF RA Breun LA, Broering TJ, McCutcheon AM, Harrison SJ, Luongo CL,
#=GF RA Nibert ML;
#=GF RL Virology 2001;287:333-348.
#=GF RN [2]
#=GF RM 10801118
#=GF RT Structure of the reovirus core at 3.6 A resolution.
#=GF RA Reinisch KM, Nibert ML, Harrison SC;
#=GF RL Nature. 2000;404:960-967.
#=GF DR INTERPRO; IPR010311;
#=GF DR SO; 0000417; polypeptide_domain;
#=GF CC Reovirus core-spike protein VP1/lambda-2 (VP1/L2) forms a
#=GF CC pentamer that mediates enzymatic reactions in 5' capping of the
#=GF CC viral plus-strand transcripts [1]. It forms a hollow cylinder
#=GF CC with projecting turrets. Each VP1/L2 monomer consists of eight
#=GF CC domains with the most N-terminal domain at the base of the
#=GF CC turret and the most C-terminal domain at the top. This entry
#=GF CC represents the C-terminal (eighth) domain which, together with
#=GF CC the sixth and seventh domains, forms a three-domain flap at the
#=GF CC top of the turret, that may serve as a gate to retard exit of
#=GF CC the 5' terminus of the mRNA [2]. This domain has a Ig-like,
#=GF CC resembling a truncated V region of an antibody light chain.
#=GF SQ 9
#=GS LMBD2_REOVL/1224-1288 AC Q91RA6.1
#=GS LMBD2_REOVD/1224-1288 AC P11079.2
#=GS A0A193BJ69_9VIRU/1231-1296 AC A0A193BJ69.1
#=GS LMBD2_REOVJ/1223-1287 AC Q91RA4.1
#=GS A0A1S6PCV8_9VIRU/1229-1294 AC A0A1S6PCV8.1
#=GS A0A0B4ULB8_9REOV/1231-1296 AC A0A0B4ULB8.1
#=GS VP1_AQRVG/1232-1297 AC B2BND9.1
#=GS VP1_AQRVC/1233-1298 AC Q8JU62.1
#=GS A0A0B5CUT9_9VIRU/1224-1288 AC A0A0B5CUT9.1
LMBD2_REOVL/1224-1288 .TNEDLFLSAPDMREWA-VKESGNTICILNSQGFVPPQDWDVLTDTISWSPSLPTYVVPPGDYTLTP
LMBD2_REOVD/1224-1288 .TNEDLFLSAPDMREWA-VKESGNTICILNSQGFVLPQDWDVLTDTISWSPSIPTYIVPPGDYTLTP
A0A193BJ69_9VIRU/1231-1296 .NNTPLLASPPYPTASGRLLLNGQVFIDLDPLPPVLPPGVQIQALSTAIEPARPTVEVPAGTYVYVV
LMBD2_REOVJ/1223-1287 .TNEDLFLSAPDMREWA-VKESGNTICILNSQGFIPPQDWDVLTDTISWSPSLPTYVVPPGDYTLTP
A0A1S6PCV8_9VIRU/1229-1294 a-NAPLFASPPYPSASGRLILAGQPFMDLDPLPQVLPPGVVQQQLSVAVQTNRPTVLLPPGAYTYVV
A0A0B4ULB8_9REOV/1231-1296 .NNTPLLASPPYPSASGRLLLNGQHFLDLDPLPPVLPPGVQLQALSTAVEAARQTVEVPAGAYTYVV
VP1_AQRVG/1232-1297 .NNTPLRASLPYIGGGARVELNNQPYLSLTNPPPVLPAGTALAALATAASVGQPTYTLPAGAYRYVL
VP1_AQRVC/1233-1298 .RNTPVRASLPYTGGGAHLTSGGNPFMSLTTPPAVLPAGVALAALSTSVATQYPTYTLPAGVYEYVI
A0A0B5CUT9_9VIRU/1224-1288 .TNEDLFLSAPDMREWA-VKESGNTICILNSQGFVLPQDWDVLTDTISWSPSIPTYIVPPGDYTLTP
#=GC seq_cons .sNpsLhhSsP.hpthA.lp.uGpshh.Lss.s.VLPtshslhs.ohuhusuhPTYhVPsGsYThss
//
