#=GF ID   SARS_3b
#=GF AC   PF12383.12
#=GF DE   Severe acute respiratory syndrome coronavirus 3b protein
#=GF AU   Gavin OL;
#=GF SE   Prosite
#=GF GA   25.00 25.00;
#=GF TC   32.80 340.80;
#=GF NC   24.90 20.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 -Z 75585367 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   16682811
#=GF RT   Mitochondrial location of severe acute respiratory syndrome
#=GF RT   coronavirus 3b protein.
#=GF RA   Yuan X, Shan Y, Yao Z, Li J, Zhao Z, Chen J, Cong Y;
#=GF RL   Mol Cells. 2006;21:186-191.
#=GF DR   INTERPRO; IPR022117;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family of proteins is found in viruses. Proteins in this
#=GF CC   family are typically between 32 and 154 amino acids in length.
#=GF CC   This family contains the SARS coronavirus 3b protein which is
#=GF CC   predominantly localized in the nucleolus, and induces G0/G1
#=GF CC   arrest and apoptosis in transfected cells.
#=GF SQ   1
#=GS NS3B_SARS/1-153  AC P59633.1
NS3B_SARS/1-153             MMPTTLFAGTHITMTTVYHITVSQIQLSLLKVTAFQHQNSKKTTKLVVILRIGTQVLKTMSLYMAISPKFTTSLSLHKLLQTLVLKMLHSSSLTSLLKTHRMCKYTQSTALQELLIQQWIQFMMSRRRLLACLCKHKKVSTNLCTHSFRKKQV
#=GC seq_cons               MMPTTLFAGTHITMTTVYHITVSQIQLSLLKVTAFQHQNSKKTTKLVVILRIGTQVLKTMSLYMAISPKFTTSLSLHKLLQTLVLKMLHSSSLTSLLKTHRMCKYTQSTALQELLIQQWIQFMMSRRRLLACLCKHKKVSTNLCTHSFRKKQV
//