#=GF ID   SMK1_alpha_su
#=GF AC   PF21415.1
#=GF DE   SMK1 alpha subunit
#=GF AU   Chuguransky S;0000-0002-0520-0736
#=GF SE   Manual
#=GF GA   27.00 27.00;
#=GF TC   36.30 139.70;
#=GF NC   23.00 21.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 --cpu 4 -Z 75585367 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   11748724
#=GF RT   Interaction of SMKT, a killer toxin produced by Pichia farinosa,
#=GF RT   with the yeast cell membranes.
#=GF RA   Suzuki C, Ando Y, Machida S;
#=GF RL   Yeast. 2001;18:1471-1478.
#=GF RN   [2]
#=GF RM   9016714
#=GF RT   The novel acidophilic structure of the killer toxin from
#=GF RT   halotolerant yeast demonstrates remarkable folding similarity
#=GF RT   with a fungal killer toxin.
#=GF RA   Kashiwagi T, Kunishima N, Suzuki C, Tsuchiya F, Nikkuni S, Arata
#=GF RA   Y, Morikawa K;
#=GF RL   Structure. 1997;5:81-94.
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   The killer toxin SMK (salt-mediated killer) from the
#=GF CC   halotolerant yeast Pichia farinosa acts to kill sensitive
#=GF CC   strains of yeast. SMK exhibits maximum activity under conditions
#=GF CC   of acidic pH and high salt concentration. It is composed of two
#=GF CC   distinct subunits, alpha and beta, which tightly interact with
#=GF CC   each other under acidic conditions, jointly folding into an
#=GF CC   ellipsoidal single domain structure belonging to the
#=GF CC   alpha/beta-sandwich family. SMK assumes a similar folding
#=GF CC   topology to the fungal killer toxin KP4, forming two left-handed
#=GF CC   split beta/alpha/beta motifs which is rarely found in other
#=GF CC   toxins; hence, these toxins may be evolutionarily or
#=GF CC   functionally related [2]. SMK appears to function by associating
#=GF CC   with the membranes of sensitive cells [1]. This entry represents
#=GF CC   SMK alpha subunit.
#=GF SQ   2
#=GS G8Y1K3_PICSO/20-81  AC G8Y1K3.1
#=GS G8Y4I0_PICSO/20-81  AC G8Y4I0.1
G8Y1K3_PICSO/20-81             SLRWRMQKSTTIAAIAGCSGAATFGGLAGGIVGCIAAGILAILQGFEVNWHNGGGGDRSNPV
G8Y4I0_PICSO/20-81             SLKWRMQKSTTVAAIAGCTGAATFGGLAGGIVGCVAAGILAILQGFEVNWHSGGGGDRSNPV
#=GC seq_cons                  SL+WRMQKSTTlAAIAGCoGAATFGGLAGGIVGClAAGILAILQGFEVNWHsGGGGDRSNPV
//