#=GF ID   Sbi-IV
#=GF AC   PF11621.12
#=GF DE   C3 binding domain 4 of IgG-bind protein SBI
#=GF AU   Pollington J;0000-0002-8158-8998
#=GF SE   pdb_2jvg
#=GF GA   25.00 25.00;
#=GF TC   25.40 155.50;
#=GF NC   24.60 21.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch --cpu 4 -E 1000 -Z 75585367 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   18550524
#=GF RT   Structure-function analysis of the C3 binding region of
#=GF RT   Staphylococcus aureus immune subversion protein Sbi. 
#=GF RA   Upadhyay A, Burman JD, Clark EA, Leung E, Isenman DE, van den
#=GF RA   Elsen JM, Bagby S; 
#=GF RL   J Biol Chem. 2008;283:22113-22120.
#=GF DR   INTERPRO; IPR021657;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This family of proteins represents Sbi domain IV which binds the
#=GF CC   central complement protein C3. Sbi-IV interacts with Sbi-III to
#=GF CC   induce a consumption of complement via alternative pathway
#=GF CC   activation [1]. When not interacting with Sbi-III, Sbi-IV
#=GF CC   inhibits the alternative pathway without complement consumption.
#=GF CC   The structure of Sbi-IV consists of a three-helix bundle fold
#=GF CC   [1].
#=GF SQ   1
#=GS SBI_STAA8/198-266  AC Q2FVK5.1
SBI_STAA8/198-266             VSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEHLQKQLDALVAQKDAEKKVA
#=GC seq_cons                 VSIEKAIVRHDERVKSANDAISKLNEKDSIENRRLAQREVNKAPMDVKEHLQKQLDALVAQKDAEKKVA
//