#=GF ID   SelB-wing_1
#=GF AC   PF09105.14
#=GF DE   Elongation factor SelB, winged helix 
#=GF AU   Sammut SJ;0000-0003-4472-904X
#=GF SE   pdb_1lva
#=GF GA   25.00 25.00;
#=GF TC   25.50 31.10;
#=GF NC   24.60 22.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 -Z 75585367 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF CL   CL0123
#=GF RN   [1]
#=GF RM   12145214
#=GF RT   Crystal structure of an mRNA-binding fragment of Moorella
#=GF RT   thermoacetica elongation factor SelB. 
#=GF RA   Selmer M, Su XD; 
#=GF RL   EMBO J. 2002;21:4145-4153.
#=GF RN   [2]
#=GF RM   17881825
#=GF RT   Conformational switches in winged-helix domains 1 and 2 of
#=GF RT   bacterial translation  elongation factor SelB.
#=GF RA   Ganichkin O, Wahl MC;
#=GF RL   Acta Crystallogr D Biol Crystallogr. 2007;63:1075-1081.
#=GF RN   [3]
#=GF RM   15665870
#=GF RT   Structural basis for mRNA recognition by elongation factor SelB.
#=GF RA   Yoshizawa S, Rasubala L, Ose T, Kohda D, Fourmy D, Maenaka K;
#=GF RL   Nat Struct Mol Biol. 2005;12:198-203.
#=GF DR   INTERPRO; IPR015189;
#=GF DR   SCOP; 1lva; fa;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   SelB (Selenocysteine-specific elongation factor) is a
#=GF CC   transcription factor necessary for the incorporation of
#=GF CC   selenocysteine into proteins and binds both transfer RNA (tRNA)
#=GF CC   and mRNA. [1,2,3]. This entry represents a domain that adopts a
#=GF CC   winged-helix fold, with an alpha/beta structure consisting of
#=GF CC   three alpha-helices and a twisted three-stranded antiparallel
#=GF CC   beta-sheet, with an alpha-beta-alpha-alpha-beta-beta
#=GF CC   connectivity. In SelB, the winged helix domains recognise RNA,
#=GF CC   allowing the complex to wrap around the small ribosomal subunit
#=GF CC   [1].
#=GF SQ   4
#=GS A0A1W1W3W5_9THEO/376-435  AC A0A1W1W3W5.1
#=GS A0A2T0AS61_9THEO/377-435  AC A0A2T0AS61.1
#=GS A0A1J5NTJ4_MOOTH/377-435  AC A0A1J5NTJ4.1
#=GS A0A829ZTW8_9THEO/377-436  AC A0A829ZTW8.1
A0A1W1W3W5_9THEO/376-435             GSLPEIFLDIIRGSKEGLELKKASAQAGLTLEEAQDVLKAEASQGKLVVLPAaEGEQYV-i
A0A2T0AS61_9THEO/377-435             GTPGEVLAQIIKEHRQGINLTEAAAAAAMNVDDARELLHGMAAEGLFVMLPC.EHDLYIV.
A0A1J5NTJ4_MOOTH/377-435             GSPEKILAQVIQEHREGLDWHEAASRASLSLEETRKLLQAMAADGQVTLLRV.ENDLYAI.
A0A829ZTW8_9THEO/377-436             GTSRDILLSVVGEEREGLSLRKAAARAEVDRKEAHEILAVAEKEGKVVLLPAgEGDLYAV.
#=GC seq_cons                        Gost-ILhplIpEcREGLsL+cAAApAulsl-EA+-lLpuhAu-GplVlLPs.EsDLYsl.
//