#=GF ID SidC_lipid-bd
#=GF AC PF20892.1
#=GF DE SidC, lipid-binding domain
#=GF AU Lazaro Pinto Beatriz;0000-0001-6837-2941
#=GF AU Bateman A;0000-0002-6982-4660
#=GF AU Chuguransky S;0000-0002-0520-0736
#=GF SE ECOD:633.26.1
#=GF GA 27.00 27.00;
#=GF TC 27.90 216.00;
#=GF NC 25.10 24.20;
#=GF BM hmmbuild HMM.ann SEED.ann
#=GF SM hmmsearch --cpu 4 -E 1000 -Z 75585367 HMM pfamseq
#=GF TP Domain
#=GF RC Paper describing PDB structure 4zuz
#=GF RN [1]
#=GF RM 26067986
#=GF RT Structure of the Legionella Virulence Factor, SidC Reveals a
#=GF RT Unique PI(4)P-Specific Binding Domain Essential for Its
#=GF RT Targeting to the Bacterial Phagosome.
#=GF RA Luo X, Wasilko DJ, Liu Y, Sun J, Wu X, Luo ZQ, Mao Y;
#=GF RL PLoS Pathog. 2015;11:e1004965.
#=GF DR SO; 0000417; polypeptide_domain;
#=GF CC SidC is one of the effectors delivered by Legionella pneumophila
#=GF CC into the host cell. Like its paralogue SdcA, SidC anchor on the
#=GF CC Legionella-containing vacuole (LCV) through binding to
#=GF CC phosphatidylinositol-4-phosphate (PI(4)P) to facilitate the
#=GF CC recruitment of endoplasmic reticulum (ER) proteins. SidC is
#=GF CC organised into four domains that are packed into an arch-like
#=GF CC shape: the N- terminal SNL domain (Pfam:PF18219), the INS domain
#=GF CC (which is inserted within the SNL domain), the PI(4)P binding
#=GF CC domain or P4C domain (this entry), and a C-terminal domain
#=GF CC (Pfam:PF20875). The lipid binding domain shows a four
#=GF CC alpha-helix bundle with one end sealed by a C-terminal short
#=GF CC beta hairpin and a highly positively charged pocket at the other
#=GF CC end formed by two loops connecting the alpha-helices.s This
#=GF CC pocket is thought to be the binding site, responsible for the
#=GF CC stimulation of the E3 ligase activity of the SNL domain [1].
#=GF SQ 3
#=GS Q5ZSK7_LEGPH/605-730 AC Q5ZSK7.1
#=GS A0A6F8T7U5_9GAMM/596-722 AC A0A6F8T7U5.1
#=GS Q5ZSK6_LEGPH/609-735 AC Q5ZSK6.1
Q5ZSK7_LEGPH/605-730 KYSSKPLLDVELNKIAEGLDLTAKIYNEKRKSEW.FKGSRNEARKTQCEELQRVSQEINALLQSESLTKSQVLEKVLNSIEALDKIDRDISAE-YNLFKSTLQKEVQSFRDQLKDICQLDNYAFKSTK
A0A6F8T7U5_9GAMM/596-722 KYSSKLLFEVELNKVADGLIRMVHVYNKKRSRQW.YKGFRDEVRIKQCEVLMQVGQEINSLLDCHPLSKEQILEKIVQSIETLNRINNEISLETSNRFQSTLQQEIKIFQAKLITLCELDSYEFISMN
Q5ZSK6_LEGPH/609-735 KYSSKPLLDVELNKIAEGLELTAKIYNEKRGREWwFKGSRNEARKTQCEELQRVSKEINTLLQSESLTKSQVLEKVLNSIETLDKIDRDISAE-SNWFQSTLQKEVRLFRDQLKDICQLDKYAFKSTK
#=GC seq_cons KYSSKPLLDVELNKIAEGL-LTAKIYNEKRuREW.FKGSRNEARKTQCEELQRVSQEINoLLQSESLTKSQVLEKVLNSIETLDKIDRDISAE.SNhFQSTLQKEV+lFRDQLKDICQLDsYAFKSTK
//