#=GF ID   Ste5
#=GF AC   PF11610.12
#=GF DE   Scaffold protein Ste5, Fus3-binding region
#=GF AU   Pollington J;0000-0002-8158-8998
#=GF SE   pdb_2f49
#=GF GA   27.00 27.00;
#=GF TC   28.60 53.30;
#=GF NC   25.40 20.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 --cpu 4 -E 1000 HMM pfamseq
#=GF TP   Motif
#=GF RN   [1]
#=GF RM   16424299
#=GF RT   The Ste5 scaffold allosterically modulates signaling output of
#=GF RT   the yeast mating pathway. 
#=GF RA   Bhattacharyya RP, Remenyi A, Good MC, Bashor CJ, Falick AM, Lim
#=GF RA   WA; 
#=GF RL   Science. 2006;311:822-826.
#=GF DR   INTERPRO; IPR021651;
#=GF DR   SO; 0001067; polypeptide_motif;
#=GF CC   This family of proteins represents the Fus3 binding region of
#=GF CC   Ste5. Ste5 functions in the yeast mating pathway and is required
#=GF CC   for signalling through the mating response MAPK pathway. Ste5
#=GF CC   has separate binding sites for each member of the MAPK cascade.
#=GF CC   This region of Ste5 allosterically activates autophosphroylation
#=GF CC   of Fus3, a mitogen-activated protein kinase. Auto-activated Fus3
#=GF CC   has a negative regulatory role, and promotes Ste5
#=GF CC   phosphorylation which leads to a decrease in pathway
#=GF CC   transcriptional output [1].
#=GF SQ   2
#=GS STE5_YEAST/287-316    AC P32917.2
#=GS J8Q9F9_SACAR/290-319  AC J8Q9F9.1
STE5_YEAST/287-316               TPVERQTIYSQAPSLNPNLILAAPPKERNQ
J8Q9F9_SACAR/290-319             TPVERQTIYSQVPNLGPNLVLATPPKDRTQ
#=GC seq_cons                    TPVERQTIYSQsPsLsPNLlLAsPPK-RsQ
//