#=GF ID Topo-V_HhH_2_2nd
#=GF AC PF21616.1
#=GF DE Topoisomerase V, second (HhH)2 tandem domain
#=GF AU Bateman A;0000-0002-6982-4660
#=GF AU Lazaro Pinto Beatriz;0000-0001-6837-2941
#=GF SE ECOD:EF19637
#=GF GA 27.00 27.00;
#=GF TC 27.00 134.90;
#=GF NC 26.60 23.50;
#=GF BM hmmbuild HMM.ann SEED.ann
#=GF SM hmmsearch -Z 75585367 --cpu 4 -E 1000 HMM pfamseq
#=GF TP Domain
#=GF CL CL0198
#=GF RC Paper describing PDB structure 2csb
#=GF RN [1]
#=GF RM 16395333
#=GF RT Structure of the N-terminal fragment of topoisomerase V reveals
#=GF RT a new family of topoisomerases.
#=GF RA Taneja B, Patel A, Slesarev A, Mondragon A;
#=GF RL EMBO J. 2006;25:398-408.
#=GF RC Paper describing PDB structure 3m6k
#=GF RN [2]
#=GF RM 20637419
#=GF RT Structures of minimal catalytic fragments of topoisomerase V
#=GF RT reveals conformational changes relevant for DNA binding.
#=GF RA Rajan R, Taneja B, Mondragon A;
#=GF RL Structure. 2010;18:829-838.
#=GF RC Paper describing PDB structure 4d49
#=GF RN [3]
#=GF RM 27664438
#=GF RT Computationally Designed Armadillo Repeat Proteins for Modular
#=GF RT Peptide Recognition.
#=GF RA Reichen C, Hansen S, Forzani C, Honegger A, Fleishman SJ, Zhou
#=GF RA T, Parmeggiani F, Ernst P, Madhurantakam C, Ewald C, Mittl PRE,
#=GF RA Zerbe O, Baker D, Caflisch A, Pluckthun A;
#=GF RL J Mol Biol. 2016;428:4467-4489.
#=GF RC Paper describing PDB structure 4gfj
#=GF RN [4]
#=GF RM 23125368
#=GF RT Identification of one of the apurinic/apyrimidinic lyase active
#=GF RT sites of topoisomerase V by structural and functional studies.
#=GF RA Rajan R, Prasad R, Taneja B, Wilson SH, Mondragon A;
#=GF RL Nucleic Acids Res. 2013;41:657-666.
#=GF RC Paper describing PDB structure 5hm5
#=GF RN [5]
#=GF RM 26908655
#=GF RT Methanopyrus kandleri topoisomerase V contains three distinct AP
#=GF RT lyase active sites in addition to the topoisomerase active site.
#=GF RA Rajan R, Osterman A, Mondragon A;
#=GF RL Nucleic Acids Res. 2016;44:3464-3474.
#=GF DR SO; 0000417; polypeptide_domain;
#=GF CC This domain is found in Topoisomerase V from Methanopyrus
#=GF CC kandleri (Topo-V), is a bifunctional enzyme carrying both
#=GF CC topoisomerase and DNA repair lyase activities. Topo-V consists
#=GF CC of an N-terminal topoisomerase domain followed by 12 tandem
#=GF CC (HhH)2 domains, showing four active sites. This entry represents
#=GF CC the second of these tandem domains [1,4,5].
#=GF SQ 1
#=GS F1SVL0_METKA/351-408 AC F1SVL0.1
F1SVL0_METKA/351-408 RTLATLIDEHGLSPDAADELIEHFESIAGILATDLEEIERMYEEGRLSEEAYRAAVEI
#=GC seq_cons RTLATLIDEHGLSPDAADELIEHFESIAGILATDLEEIERMYEEGRLSEEAYRAAVEI
//
