#=GF ID   Toxofilin-like_dom
#=GF AC   PF21609.1
#=GF DE   Toxofilin-like domain
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF AU   Lazaro Pinto Beatriz;0000-0001-6837-2941
#=GF SE   ECOD:EF19533
#=GF GA   27.00 27.00;
#=GF TC   31.90 155.90;
#=GF NC   24.70 20.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 -Z 75585367 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RC   Paper describing PDB structure 2q97
#=GF RN   [1]
#=GF RM   17911258
#=GF RT   Toxofilin from Toxoplasma gondii forms a ternary complex with an
#=GF RT   antiparallel actin dimer.
#=GF RA   Lee SH, Hayes DB, Rebowski G, Tardieux I, Dominguez R;
#=GF RL   Proc Natl Acad Sci U S A. 2007;104:16122-16127.
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This domain is found in a group of sequences from eukaryotic
#=GF CC   parasites, including Toxofilin from Toxoplasma gondii, an
#=GF CC   actin-binding protein involved in invasion. This domain
#=GF CC   interacts with the host mammalian actin. It folds into five
#=GF CC   helices connected by loops [1].
#=GF SQ   2
#=GS B9QND9_TOXGV/84-167   AC B9QND9.1
#=GS F0VKV6_NEOCL/128-211  AC F0VKV6.1
B9QND9_TOXGV/84-167              GQAKQAALQTAHQLGAFVLTPEQARAALLDEILRATQNLNLGKYENLNTDQQQAYEQVKKDLLEMSPETKSLLIENRKKEQGLL
F0VKV6_NEOCL/128-211             GKILEAARKIAHQHGGLLMNPGQIRAAMLTEFMNTLNRIDLSKYENLNADQQRDYEDTQQSINAMSPEQKAALISSYQNEKKKT
#=GC seq_cons                    GphhpAAhphAHQhGuhlhsPtQhRAAhLsEhhpshpplsLuKYENLNsDQQpsYEpsppsl.tMSPEpKuhLIpshppEpthh
//