#=GF ID   V-cyclin_C
#=GF AC   PF21608.1
#=GF DE   V-cyclin, C-terminal domain
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF AU   Lazaro Pinto Beatriz;0000-0001-6837-2941
#=GF SE   ECOD:EF19519
#=GF GA   27.00 27.00;
#=GF TC   27.70 222.60;
#=GF NC   25.70 19.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch --cpu 4 -E 1000 -Z 75585367 HMM pfamseq
#=GF TP   Domain
#=GF CL   CL0065
#=GF RC   Paper describing PDB structure 1f5q
#=GF RN   [1]
#=GF RM   10856233
#=GF RT   Crystal structure of a gamma-herpesvirus cyclin-cdk complex.
#=GF RA   Card GL, Knowles P, Laman H, Jones N, McDonald NQ;
#=GF RL   EMBO J. 2000;19:2877-2888.
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This domain is found at the C-terminal end of V-cyclin from
#=GF CC   Murid herpesvirus 4 (MuHV-4) and similar proteins predominantly
#=GF CC   from gamma-herpesvirus. This domain shows an all-alpha fold
#=GF CC   structure [1]. It is usually associated with Pfam:PF00134.
#=GF SQ   1
#=GS P89883_MHV68/148-244  AC P89883.1
P89883_MHV68/148-244             LSTDLICYILHIMHAPREDYLNIYNLCHPKIFCALCDGRSAMKRPVLITLACMHLTMNQKYDYYENRIDGVCKSLYITKEELHQCCDLVDIAIVSFD
#=GC seq_cons                    LSTDLICYILHIMHAPREDYLNIYNLCHPKIFCALCDGRSAMKRPVLITLACMHLTMNQKYDYYENRIDGVCKSLYITKEELHQCCDLVDIAIVSFD
//