#=GF ID   VMAP-M15
#=GF AC   PF20017.3
#=GF DE   vWA-MoxR associated protein middle region (VMAP-M) 15
#=GF AU   Aravind L;0000-0003-0771-253X
#=GF AU   Iyer LM;0000-0002-4844-2022
#=GF SE   Aravind L
#=GF GA   27.00 27.00;
#=GF TC   42.70 181.90;
#=GF NC   26.20 20.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   32101166
#=GF RT   Highly regulated, diversifying NTP-dependent biological conflict
#=GF RT   systems with implications for the emergence of multicellularity.
#=GF RA   Kaur G, Burroughs AM, Iyer LM, Aravind L;
#=GF RL   Elife. 2020; [Epub ahead of print]
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Highly variable central region of the vWA-MoxR associated
#=GF CC   protein (VMAP) of the classical ternary system (vWA-MoxR-VMAP)
#=GF CC   in NTP-dependent conflict systems. VMAP-Ms may be involved in
#=GF CC   sensing of invasive entities.
#=GF SQ   1
#=GS H5WJ31_9BURK/286-366  AC H5WJ31.1
H5WJ31_9BURK/286-366             LVDSLRALKWPPQRLAQQALRCLGADSAWPDDDRLGDLQGLVAFLDDQPQARGWPPLTEFVHRLLAAGAQSTALQRWLDLH
#=GC seq_cons                    LVDSLRALKWPPQRLAQQALRCLGADSAWPDDDRLGDLQGLVAFLDDQPQARGWPPLTEFVHRLLAAGAQSTALQRWLDLH
//