GenomeNet

Database: Pfam
Entry: WW_like
LinkDB: WW_like
Original site: WW_like 
#=GF ID   WW_like
#=GF AC   PF17890.5
#=GF DE   Peptidoglycan hydrolase LytB WW-like domain 
#=GF AU   El-Gebali S;0000-0003-1378-5495
#=GF SE   ECOD:EUF00655
#=GF GA   37.80 37.80;
#=GF TC   71.30 71.30;
#=GF NC   34.10 23.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -E 1000 -Z 75585367 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   25002590
#=GF RT   Structure of pneumococcal peptidoglycan hydrolase LytB reveals
#=GF RT   insights into the        bacterial cell wall remodeling and
#=GF RT   pathogenesis.
#=GF RA   Bai XH, Chen HJ, Jiang YL, Wen Z, Huang Y, Cheng W, Li Q, Qi L,
#=GF RA   Zhang JR, Chen Y, Zhou CZ;
#=GF RL   J Biol Chem. 2014;289:23403-23416.
#=GF DR   INTERPRO; IPR040742;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   Structural analysis revealed that the catalytic domain of LytB
#=GF CC   consists of three structurally independent modules: SH3b, WW
#=GF CC   domain-like, and the glycoside hydrolase family 73 (GH73). This
#=GF CC   entry is the WW like domain found in
#=GF CC   endo-beta-N-acetylglucosaminidase LytB from Streptococcus
#=GF CC   pneumoniae. Functional analysis show that the deletion of both
#=GF CC   SH3b and WW modules almost completely abolished the activity of
#=GF CC   LytB. Furthermore, it was shown that the SH3b and WW modules are
#=GF CC   indispensable for LytB in cell separation [1].
#=GF SQ   5
#=GS J1DJ95_STREE/181-233      AC J1DJ95.1
#=GS F9PWK5_9STRE/490-542      AC F9PWK5.1
#=GS LYTB_STRR6/496-548        AC P59206.1
#=GS A0A2X4N2H5_9BACL/448-500  AC A0A2X4N2H5.1
#=GS A5M7A1_STREE/496-548      AC A5M7A1.1
J1DJ95_STREE/181-233                 .DFIPYYESDGHRFYHYVAQNASIPVASHLSDMEVGKKYYSADGLHFDGFKLEN.
F9PWK5_9STRE/490-542                 .EFIPHYTSDGRYIYHELSPYTSIRVAPHSSSMEIGKKYYSADGVNFDTFKVEN.
LYTB_STRR6/496-548                   .DFIPYYESDGHRFYHYVAQNASIPVASHLSDMEVGKKYYSADGLHFDGFKLEN.
A0A2X4N2H5_9BACL/448-500             t-FIPDYVSDGKYVYHRYSQYSKVMVARHHQDMVVGKSYYSADGINFGTFKLD-h
A5M7A1_STREE/496-548                 .DFIPYYESDGHRFYHYVAQNASIPVASHLSDMEVGKKYYSADGLHFDGFKLEN.
#=GC seq_cons                        .DFIPYYESDGHRFYHYVAQNASIPVASHLSDMEVGKKYYSADGLHFDGFKLEN.
//
DBGET integrated database retrieval system