#=GF ID bCoV_NS6
#=GF AC PF12133.12
#=GF DE Betacoronavirus NS6 protein
#=GF PI Sars6; Corona_NS6;
#=GF AU Assefa S;0000-0003-2178-533X
#=GF AU Bateman A;0000-0002-6982-4660
#=GF AU Coggill P;0000-0001-5731-1588
#=GF AU Chuguransky S;0000-0002-0520-0736
#=GF SE PfamB-2188 (release 23.0)
#=GF GA 27.00 27.00;
#=GF TC 108.40 108.30;
#=GF NC 20.70 18.90;
#=GF BM hmmbuild HMM.ann SEED.ann
#=GF SM hmmsearch --cpu 4 -E 1000 -Z 75585367 HMM pfamseq
#=GF TP Family
#=GF RN [1]
#=GF RM 17108045
#=GF RT Severe acute respiratory syndrome coronavirus protein 6
#=GF RT accelerates murine coronavirus infections.
#=GF RA Tangudu C, Olivares H, Netland J, Perlman S, Gallagher T;
#=GF RL J Virol. 2007;81:1220-1229.
#=GF RN [2]
#=GF RM 16310783
#=GF RT The putative protein 6 of the severe acute respiratory
#=GF RT syndrome-associated coronavirus: expression and functional
#=GF RT characterization.
#=GF RA Geng H, Liu YM, Chan WS, Lo AW, Au DM, Waye MM, Ho YY;
#=GF RL FEBS Lett. 2005;579:6763-6768.
#=GF RN [3]
#=GF RM 25907116
#=GF RT Severe acute respiratory syndrome coronavirus protein 6 mediates
#=GF RT ubiquitin-dependent proteosomal degradation of N-Myc (and STAT)
#=GF RT interactor.
#=GF RA Cheng W, Chen S, Li R, Chen Y, Wang M, Guo D;
#=GF RL Virol Sin. 2015;30:153-161.
#=GF DR INTERPRO; IPR022736;
#=GF DR SO; 0100021; polypeptide_conserved_region;
#=GF CC This entry represents non-structural protein NS6 (also known as
#=GF CC non-structural protein 6, accessory protein 6, or X3 protein),
#=GF CC which is highly conserved among SARS-related coronaviruses [2].
#=GF CC (This is distinct from NSP6 which is encoded on the replicase
#=GF CC polyprotein). Proteins in this family are typically between 42
#=GF CC to 63 amino acids in length. NS6 is located in the endoplasmic
#=GF CC reticulum [2]. It has been reported that NS6 can increase the
#=GF CC cellular gene synthesis and it can also induce apoptosis through
#=GF CC Jun N-terminal kinase and Caspase-3 mediated stress. This
#=GF CC protein can modulate host antiviral responses by inhibiting
#=GF CC synthesis and signalling of IFN-beta, via NS6 interaction with
#=GF CC host N-Myc (and STAT) interactor (Nmi) protein and suppressing
#=GF CC the translocation of signal transducer and activator of
#=GF CC transcription 1 (STAT1) [3].
#=GF SQ 4
#=GS NS6_SARS/1-62 AC P59634.1
#=GS A0A0K1Z0N6_SARS/1-62 AC A0A0K1Z0N6.1
#=GS NS6_SARS2/1-61 AC P0DTC6.1
#=GS Q0Q480_SARS/1-62 AC Q0Q480.1
NS6_SARS/1-62 MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMELDY
A0A0K1Z0N6_SARS/1-62 MFHLVDFQVTIAEILVIIMRTFRIAIWNLDMITSSIVTQLFKPLTKKKYSELDDEVPMEIDY
NS6_SARS2/1-61 MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID-
Q0Q480_SARS/1-62 MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVLISSIVRQLFKPLTKKKYPQLDDEEPMELDY
#=GC seq_cons MFHLVDFQVTIAEILlIIMRTFRIAIWNLDhIISSIV+QLFKPLTKKKYSpLDDEpPMElDY
//
