#=GF ID   bDLD2
#=GF AC   PF20707.1
#=GF DE   Bacterial Death-like domain 2
#=GF AU   Aravind L;0000-0003-0771-253X
#=GF AU   Iyer LM;0000-0002-4844-2022
#=GF AU   Chuguransky S;0000-0002-0520-0736
#=GF SE   Aravind L
#=GF GA   25.00 25.00;
#=GF TC   25.40 93.80;
#=GF NC   24.70 20.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch --cpu 4 -E 1000 -Z 75585367 HMM pfamseq
#=GF TP   Domain
#=GF CL   CL0041
#=GF RN   [1]
#=GF RM   32101166
#=GF RT   Highly regulated, diversifying NTP-dependent biological conflict
#=GF RT   systems with implications for the emergence of multicellularity.
#=GF RA   Kaur G, Burroughs AM, Iyer LM, Aravind L;
#=GF RL   Elife. 2020; [Epub ahead of print]
#=GF RN   [2]
#=GF RM   34061031
#=GF RT   Bacterial death and TRADD-N domains help define novel apoptosis
#=GF RT   and immunity mechanisms shared by prokaryotes and metazoans.
#=GF RA   Kaur G, Iyer LM, Burroughs AM, Aravind L;
#=GF RL   Elife. 2021; [Epub ahead of print]
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This bacterial adaptor domain of the Death-domain fold is
#=GF CC   involved in protein-protein interactions in biological conflict
#=GF CC   systems. bDLDs show a characteristic architectural pattern. One
#=GF CC   copy is always fused, typically to the N- or C-terminus, of a
#=GF CC   core component of a biological conflict system; examples include
#=GF CC   VMAP and iSTAND. Further copies of the same bDLD are fused to
#=GF CC   either effector or signal-transducing domains, or additional
#=GF CC   Effector-associated domains (EADs). bDLD pairs are frequently
#=GF CC   observed together on the genome in conserved gene neighborhoods,
#=GF CC   but can also be severed from such neighborhoods and located in
#=GF CC   distant regions, indicating the bDLD-bDLD coupling approximates
#=GF CC   the advantages of collinear transcription [1,2].
#=GF SQ   3
#=GS A0A7R7HCV9_9HYPH/6-98  AC A0A7R7HCV9.1
#=GS A0A163UQY5_9HYPH/6-98  AC A0A163UQY5.1
#=GS A0A4Q9GNV0_9HYPH/6-98  AC A0A4Q9GNV0.1
A0A7R7HCV9_9HYPH/6-98             AELDALAAACTEHLHPGRLETAARQYQIAVDIDAFIKAHSAGRSSGELSVARAILDALNELEIACDLAERLYFEMDTVEAFQAVVGPLTRSAK.
A0A163UQY5_9HYPH/6-98             EDLKNLAEACARYLNPGRLERFVLEARLVEDIEALKKRHLVGAADVSLALSMAFLELLNEHDLACDVVEKLYFEMSWSPDFQAAAGPHTRSAR.
A0A4Q9GNV0_9HYPH/6-98             NDIDVIARAIAEAVPEDLLVQVVARQNQIPDLDDLRKTAVDADRGRLYALAAAVLSQYDAKARVHELLLELYRKVDWSPTFLRTIDPFAVDP-g
#=GC seq_cons                     sDLDsLAcACAEaLsPGRLEpsVtctpllsDIDAL+KsHlsGcuuspLALAtAlL-tLNE+-lACDLlE+LYFEMDWSPsFQAslGPaTRSA+.
//