#=GF ID   p12I
#=GF AC   PF12233.12
#=GF DE   Human adult T cell leukemia/lymphoma virus protein
#=GF AU   Assefa S;0000-0003-2178-533X
#=GF AU   Gavin OL;
#=GF SE   PFAM-B_2655 (release 23.0)
#=GF GA   25.00 25.00;
#=GF TC   36.60 168.70;
#=GF NC   23.70 23.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 75585367 --cpu 4 -E 1000 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   10400740
#=GF RT   A lysine-to-arginine change found in natural alleles of the
#=GF RT   human T-cell lymphotropic/leukemia virus type 1 p12(I) protein
#=GF RT   greatly influences its stability.
#=GF RA   Trovato R, Mulloy JC, Johnson JM, Takemoto S, de Oliveira MP,
#=GF RA   Franchini G;
#=GF RL   J Virol. 1999;73:6460-6467.
#=GF DR   INTERPRO; IPR021086;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family of proteins is found in viruses. Proteins in this
#=GF CC   family are approximately 100 amino acids in length. p12I binds
#=GF CC   to the immature beta and gamma-c chains of the interleukin-2
#=GF CC   receptor retarding their translocation to the plasma membrane.
#=GF CC   p12I forms dimers which bind to these chains.
#=GF SQ   2
#=GS P12I_HTL1A/1-99  AC P0C215.1
#=GS P12I_HTL1C/1-99  AC P0CK16.1
P12I_HTL1A/1-99             MLFRLLSPLSPLALTALLLFLLPPSDVSGLLLRPPPAPCLLLFLPFQILSGLLFLLFLPLFFSLPLLLSPSLPITMRFPARWRFLPWKAPSQPAAAFLF
P12I_HTL1C/1-99             MLFRLLSPLSPLALTALLLFLLSPGEVSGLLLRPLPAPCLLLFLPFQILSNLLFLLFLPLFFSLPLLLSPSLPITMRFPARWRFPPWRAPSQPAAAFLF
#=GC seq_cons               MLFRLLSPLSPLALTALLLFLLsPu-VSGLLLRP.PAPCLLLFLPFQILSsLLFLLFLPLFFSLPLLLSPSLPITMRFPARWRF.PW+APSQPAAAFLF
//