KEGG   Rattus norvegicus (rat): 24605
Entry
24605             CDS       T01003                                 
Symbol
Nras
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04062  Chemokine signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04714  Thermogenesis
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04730  Long-term depression
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04929  GnRH secretion
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05034  Alcoholism
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05207  Chemical carcinogenesis - receptor activation
rno05208  Chemical carcinogenesis - reactive oxygen species
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24605 (Nras)
   04012 ErbB signaling pathway
    24605 (Nras)
   04014 Ras signaling pathway
    24605 (Nras)
   04015 Rap1 signaling pathway
    24605 (Nras)
   04370 VEGF signaling pathway
    24605 (Nras)
   04371 Apelin signaling pathway
    24605 (Nras)
   04068 FoxO signaling pathway
    24605 (Nras)
   04072 Phospholipase D signaling pathway
    24605 (Nras)
   04071 Sphingolipid signaling pathway
    24605 (Nras)
   04151 PI3K-Akt signaling pathway
    24605 (Nras)
   04150 mTOR signaling pathway
    24605 (Nras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    24605 (Nras)
   04137 Mitophagy - animal
    24605 (Nras)
  09143 Cell growth and death
   04210 Apoptosis
    24605 (Nras)
   04218 Cellular senescence
    24605 (Nras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    24605 (Nras)
   04550 Signaling pathways regulating pluripotency of stem cells
    24605 (Nras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24605 (Nras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    24605 (Nras)
   04650 Natural killer cell mediated cytotoxicity
    24605 (Nras)
   04660 T cell receptor signaling pathway
    24605 (Nras)
   04662 B cell receptor signaling pathway
    24605 (Nras)
   04664 Fc epsilon RI signaling pathway
    24605 (Nras)
   04062 Chemokine signaling pathway
    24605 (Nras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    24605 (Nras)
   04929 GnRH secretion
    24605 (Nras)
   04912 GnRH signaling pathway
    24605 (Nras)
   04915 Estrogen signaling pathway
    24605 (Nras)
   04917 Prolactin signaling pathway
    24605 (Nras)
   04921 Oxytocin signaling pathway
    24605 (Nras)
   04926 Relaxin signaling pathway
    24605 (Nras)
   04935 Growth hormone synthesis, secretion and action
    24605 (Nras)
   04919 Thyroid hormone signaling pathway
    24605 (Nras)
   04916 Melanogenesis
    24605 (Nras)
  09156 Nervous system
   04725 Cholinergic synapse
    24605 (Nras)
   04726 Serotonergic synapse
    24605 (Nras)
   04720 Long-term potentiation
    24605 (Nras)
   04730 Long-term depression
    24605 (Nras)
   04722 Neurotrophin signaling pathway
    24605 (Nras)
  09158 Development and regeneration
   04360 Axon guidance
    24605 (Nras)
  09149 Aging
   04211 Longevity regulating pathway
    24605 (Nras)
   04213 Longevity regulating pathway - multiple species
    24605 (Nras)
  09159 Environmental adaptation
   04714 Thermogenesis
    24605 (Nras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24605 (Nras)
   05206 MicroRNAs in cancer
    24605 (Nras)
   05205 Proteoglycans in cancer
    24605 (Nras)
   05207 Chemical carcinogenesis - receptor activation
    24605 (Nras)
   05208 Chemical carcinogenesis - reactive oxygen species
    24605 (Nras)
   05203 Viral carcinogenesis
    24605 (Nras)
   05230 Central carbon metabolism in cancer
    24605 (Nras)
   05231 Choline metabolism in cancer
    24605 (Nras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    24605 (Nras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    24605 (Nras)
   05225 Hepatocellular carcinoma
    24605 (Nras)
   05226 Gastric cancer
    24605 (Nras)
   05214 Glioma
    24605 (Nras)
   05216 Thyroid cancer
    24605 (Nras)
   05221 Acute myeloid leukemia
    24605 (Nras)
   05220 Chronic myeloid leukemia
    24605 (Nras)
   05218 Melanoma
    24605 (Nras)
   05211 Renal cell carcinoma
    24605 (Nras)
   05219 Bladder cancer
    24605 (Nras)
   05215 Prostate cancer
    24605 (Nras)
   05213 Endometrial cancer
    24605 (Nras)
   05224 Breast cancer
    24605 (Nras)
   05223 Non-small cell lung cancer
    24605 (Nras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24605 (Nras)
   05170 Human immunodeficiency virus 1 infection
    24605 (Nras)
   05161 Hepatitis B
    24605 (Nras)
   05160 Hepatitis C
    24605 (Nras)
   05163 Human cytomegalovirus infection
    24605 (Nras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24605 (Nras)
   05165 Human papillomavirus infection
    24605 (Nras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24605 (Nras)
   05022 Pathways of neurodegeneration - multiple diseases
    24605 (Nras)
  09165 Substance dependence
   05034 Alcoholism
    24605 (Nras)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24605 (Nras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    24605 (Nras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24605 (Nras)
   01522 Endocrine resistance
    24605 (Nras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24605 (Nras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24605 (Nras)
   04031 GTP-binding proteins [BR:rno04031]
    24605 (Nras)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    24605 (Nras)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    24605 (Nras)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24605 (Nras)
  Exosomal proteins of other body fluids (saliva and urine)
   24605 (Nras)
  Exosomal proteins of breast cancer cells
   24605 (Nras)
  Exosomal proteins of colorectal cancer cells
   24605 (Nras)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    24605 (Nras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 24605
NCBI-ProteinID: NP_542944
RGD: 3205
Ensembl: ENSRNOG00000023079
UniProt: Q04970 A6K3K2
Position
2:193271399..193282023
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggcgttgggaaaagtgctttgaca
atccagctaatccagaaccactttgtggatgaatatgatcccaccatagaggattcttac
cgaaaacaagtggtgattgacggtgagacctgtctactggacatactggacacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaagggttcctctgt
gtgtttgccatcaataatagcaaatcctttgcagatattaacctctacagggagcaaatt
aagcgcgtgaaagactctgatgatgtacccatggtgctggtagggaacaagtgtgacttg
ccaacaaggacagttgacacaaagcaagcccacgagctggccaagagttatggaattcca
ttcattgaaacctcagccaagacccgacagggtgtggaggatgccttttacacgcttgta
agggagatacgccagtaccggatgaagaagctcaacagcagtgaggatggcactcaaggc
tgtatggggctgccctgtgtggtgatgtag

  All links  
Ontology (4)   
   KEGG BRITE (4)   
Pathway (80)   
   KEGG PATHWAY (80)   
Genome (1)   
   KEGG GENOME (1)   
Gene (6)   
   KEGG ORTHOLOGY (1)   
   NCBI-PROTEINID (1)   
   NCBI-Gene (1)   
   Ensembl (1)   
   OC (1)   
   RGD (1)   
Protein sequence (5)   
   UniProt (2)   
   SWISS-PROT (1)   
   RefSeq(pep) (2)   
DNA sequence (4)   
   RefSeq(nuc) (2)   
   GenBank (1)   
   EMBL (1)   
Protein domain (9)   
   Pfam (9)   
All databases (109)   

Download RDF
DBGET integrated database retrieval system